Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62420 408 / 1e-143 NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G37770 286 / 6e-96 ChlAKR, AKR4C9 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G37790 275 / 1e-91 AKR4C10 Aldo-keto reductase family 4 member C10, NAD(P)-linked oxidoreductase superfamily protein (.1) AT3G53880 267 / 2e-88 AKR4C11 Aldo-keto reductase family 4 member C11, NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G59960 253 / 7e-83 NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G37760 252 / 2e-82 AKR4C8 Aldo-keto reductase family 4 member C8, NAD(P)-linked oxidoreductase superfamily protein AT1G59950 232 / 2e-74 NAD(P)-linked oxidoreductase superfamily protein (.1) AT5G01670 229 / 3e-73 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G21250 211 / 1e-66 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G21260 211 / 2e-66 NAD(P)-linked oxidoreductase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031162 [exp] 521 / 0 AT5G62420 431 / 1e-152 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10031739 [exp] 514 / 0 AT5G62420 425 / 2e-150 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10010885 [exp] 265 / 3e-87 AT2G37770 502 / 0.0 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10010884 [exp] 262 / 2e-86 AT2G37770 484 / 5e-174 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10010720 [exp] 261 / 6e-86 AT1G59960 410 / 2e-144 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10029208 [exp] 259 / 4e-85 AT1G59960 406 / 7e-143 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10024353 [exp] 254 / 3e-83 AT2G37770 491 / 1e-176 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10011056 [exp] 241 / 6e-78 AT1G59960 325 / 8e-111 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10024354 [exp] 247 / 1e-77 AT2G37770 467 / 2e-163 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G125400 [exp] 453 / 1e-161 AT5G62420 445 / 2e-158 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.006G090600 [exp] 271 / 4e-90 AT2G37770 503 / 0.0 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.005G097000 [exp] 266 / 1e-87 AT1G59960 405 / 2e-142 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.016G102300 [exp] 265 / 2e-87 AT2G37770 398 / 5e-140 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.008G193100 [exp] 262 / 2e-86 AT1G59960 420 / 3e-148 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.016G102032 [exp] 255 / 1e-83 AT2G37770 424 / 2e-150 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102100 [exp] 242 / 2e-78 AT2G37770 400 / 5e-141 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.017G070600 [exp] 225 / 5e-72 AT2G37770 438 / 6e-156 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.009G125100 [exp] 201 / 2e-62 AT2G21250 526 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.010G097800 [exp] 196 / 3e-60 AT2G37770 250 / 3e-81 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00248 [flax] [poplar] Aldo_ket_red Aldo/keto reductase family
Representative CDS sequence Show only first row Show all	>Lus10027216 pacid=23145500 polypeptide=Lus10027216 locus=Lus10027216.g ID=Lus10027216.BGIv1.0 annot-version=v1.0 ATGAAGAAGAGCAACATTGTGAGGGAAGTTGTGTTGAACAATGGGGTGAGAATGCCTTTGGTGGGGCTCGGTACTTACTCGGCTCAAAATGACTCGTACT CTACCCAACATGCCATTCACCTCGCCCTTCAGATGGGATACATGCATTTTGACACAGCGAAGATATACGGATCGGAACCACATGTTGGCAAAGCACTGGC CAATGCATTCAACCACGGGGTTGTGGAGAGGAAAGACGTCTTTGTGACTTCCAAATTATGGGGGAGCGATCACCACGACCCGGTCTCCGCCCTTCGACGC ACTCTCAAAAACTTGAAGATGGAGTATCTGGACTTGTACTTGGTTCACTGGCCAGTGAAGCTAAAGCCATGGGCCTGCAATCCAATACCTGAAGAGAGTG AGTTTGATGGGCTGGACCTTGAATCAACTTGGGCCGGAATGGAGCAATGCATCGAATTGGGCCTATGCCGTAGCATCGGCGTCAGCAACTTTTCTTCCTC CAAAGTTCAATCCTTACTCGGTTTTGCCTCCATCCCTCCGGTGGTTAACCAGGTGGAAATGCACCCAATGTGGAGGCAAAGCAGGCTAAGAGAAGTCTGT AAGGAGAACAACATCCACGTTAGTGCATACTCCCCACTTGGTGGGCCTGGAAATGCTTGGGGATCCACAGCCGTGGTGGAGAGCCCAATAATCCAGTCCA TAGCCCACAAACACGGAGCGAGCCCGGCCCAAGTAGCCCTCCAATGGGGACTCTCCAAGGGAGCTAGCGTTATAGTCAAGAGCTTCAATTCCAAGAGGAT CAGAGAGAACATGGATGCGTTTCACCTGAAACTTGACGACGAAGAAATCGACGAAATCGATCAGCTGCTTCCGGAGTGGAAAATCATGAGAGGGGAGTTC CACATCAACAACACGACCAGCCCTTACCAGTCGCTCGAAGAGCTCTGGGATGGCGAAATTTGA
AA sequence Show only first row Show all	>Lus10027216 pacid=23145500 polypeptide=Lus10027216 locus=Lus10027216.g ID=Lus10027216.BGIv1.0 annot-version=v1.0 MKKSNIVREVVLNNGVRMPLVGLGTYSAQNDSYSTQHAIHLALQMGYMHFDTAKIYGSEPHVGKALANAFNHGVVERKDVFVTSKLWGSDHHDPVSALRR TLKNLKMEYLDLYLVHWPVKLKPWACNPIPEESEFDGLDLESTWAGMEQCIELGLCRSIGVSNFSSSKVQSLLGFASIPPVVNQVEMHPMWRQSRLREVC KENNIHVSAYSPLGGPGNAWGSTAVVESPIIQSIAHKHGASPAQVALQWGLSKGASVIVKSFNSKRIRENMDAFHLKLDDEEIDEIDQLLPEWKIMRGEF HINNTTSPYQSLEELWDGEI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G62420			NAD(P)-linked oxidoreductase s...		Lus10027216 [exp]	0	1
AT2G40410			Staphylococcal nuclease homolo...		Lus10041146 [exp]	4.7	0.7927
AT2G46760			D-arabinono-1,4-lactone oxidas...		Lus10010105 [exp]	5.3	0.7208
AT5G53840			F-box/RNI-like/FBD-like domain...		Lus10025675 [exp]	7.3	0.7132
AT1G60400			F-box/RNI-like superfamily pro...		Lus10038935 [exp]	8.5	0.7132
AT3G42640		AHA8	H\(+\)-ATPase 8, H\(+\)-ATPase...		Lus10019063 [exp]	15.1	0.6080
AT5G17430	AP2_ERF	BBM	BABY BOOM, Integrase-type DNA-...		Lus10011303 [exp]	15.6	0.6727
AT1G75790		SKS18	SKU5 similar 18 (.1)		Lus10038672 [exp]	16.4	0.6720
AT3G05610			Plant invertase/pectin methyle...		Lus10020681 [exp]	17.1	0.6747
AT4G34880			Amidase family protein (.1)		Lus10002805 [exp]	19.7	0.6461
AT2G24100		ASG1	ALTERED SEED GERMINATION 1, un...		Lus10029847 [exp]	22.0	0.6496

Compare expression of checked genes

Lus10027216 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.