Lus10027228 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G05000 134 / 1e-40 VPS28-2, VPS28-1 vacuolar protein sorting-associated protein 28 homolog 1, Vacuolar protein sorting-associated protein VPS28 family protein (.1.2)
AT4G21560 126 / 2e-37 VPS28-1 vacuolar protein sorting 28, vacuolar protein sorting-associated protein 28 homolog 1 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011243 0 / 1 AT4G05000 383 / 1e-137 vacuolar protein sorting-associated protein 28 homolog 1, Vacuolar protein sorting-associated protein VPS28 family protein (.1.2)
Lus10018442 0 / 1 AT4G05000 384 / 1e-137 vacuolar protein sorting-associated protein 28 homolog 1, Vacuolar protein sorting-associated protein VPS28 family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G035500 132 / 1e-39 AT4G05000 366 / 8e-131 vacuolar protein sorting-associated protein 28 homolog 1, Vacuolar protein sorting-associated protein VPS28 family protein (.1.2)
Potri.011G043800 128 / 3e-38 AT4G05000 364 / 7e-130 vacuolar protein sorting-associated protein 28 homolog 1, Vacuolar protein sorting-associated protein VPS28 family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0596 VPS23_C PF03997 VPS28 VPS28 protein
Representative CDS sequence
>Lus10027228 pacid=23145534 polypeptide=Lus10027228 locus=Lus10027228.g ID=Lus10027228.BGIv1.0 annot-version=v1.0
ATGCCAGAAGCTCATCGCTCATTCCAAGACACTGTCCTCAACCTTAAAGGACCAGATCCCGAGCATCGAGAGGTTTGCAGACAGCTACAAGATGGACTGC
CTCGCGGCCATAAACCGACTTGTGATATCCGGTGTTCCTGCCACTGTGGAACACAGGACAACGGTGGCTGCATCTTCGACTACATCGGCTGCAACGGGTG
CGTGCAGAACTATATAACTGCGATGGACTCGTTGAAGCTGAACATGGTCACTGTTGACCAGGTGCATCCTTTGCTGTCGGATCTATCGGCCTCGCTTAAC
AAGCTGAGCATCTTGCCACCTGATTTCAAAGGGAAGATGAAGATGAAAGAGTGGATTTCGAGGATGGCTAAGATGGGGGCGTCTGATGAGCTGACCGAGC
AGTAG
AA sequence
>Lus10027228 pacid=23145534 polypeptide=Lus10027228 locus=Lus10027228.g ID=Lus10027228.BGIv1.0 annot-version=v1.0
MPEAHRSFQDTVLNLKGPDPEHREVCRQLQDGLPRGHKPTCDIRCSCHCGTQDNGGCIFDYIGCNGCVQNYITAMDSLKLNMVTVDQVHPLLSDLSASLN
KLSILPPDFKGKMKMKEWISRMAKMGASDELTEQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G05000 VPS28-2, VPS28-... vacuolar protein sorting-assoc... Lus10027228 0 1
AT1G80920 AtToc12, AtJ8, ... translocon at the outer envelo... Lus10026061 2.8 0.8263
AT5G64500 Major facilitator superfamily ... Lus10002935 4.1 0.8411
AT2G03810 18S pre-ribosomal assembly pro... Lus10019193 10.5 0.8092
AT4G36850 PQ-loop repeat family protein ... Lus10022491 10.8 0.7685
AT3G10260 Reticulon family protein (.1.2... Lus10020718 13.6 0.8301
AT2G46910 Plastid-lipid associated prote... Lus10010277 15.7 0.8134
AT5G67480 ATBT4, BT4 BTB and TAZ domain protein 4 (... Lus10011523 17.4 0.8008
AT3G29270 RING/U-box superfamily protein... Lus10015732 19.8 0.7876
AT3G14130 Aldolase-type TIM barrel famil... Lus10013173 20.3 0.8136
AT1G65420 NPQ7 NONPHOTOCHEMICAL QUENCHING 7, ... Lus10039937 21.4 0.8116

Lus10027228 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.