Lus10027229 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G23220 54 / 7e-09 CRK14 cysteine-rich RLK (RECEPTOR-like protein kinase) 14 (.1)
AT4G21400 52 / 2e-08 CRK28 cysteine-rich RLK (RECEPTOR-like protein kinase) 28 (.1)
AT4G21410 52 / 3e-08 CRK29 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
AT4G00970 52 / 3e-08 CRK41 cysteine-rich RLK (RECEPTOR-like protein kinase) 41 (.1)
AT4G21380 51 / 3e-08 ARK3 receptor kinase 3 (.1)
AT1G65790 51 / 6e-08 ARK1 receptor kinase 1 (.1)
AT1G65800 51 / 6e-08 ARK2 receptor kinase 2 (.1)
AT4G11480 50 / 7e-08 CRK32 cysteine-rich RLK (RECEPTOR-like protein kinase) 32 (.1)
AT4G23190 50 / 1e-07 AT-RLK3, CRK11 RECEPTOR LIKE PROTEIN KINASE 3, cysteine-rich RLK (RECEPTOR-like protein kinase) 11 (.1)
AT4G23310 49 / 2e-07 CRK23 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038940 109 / 3e-29 AT4G23180 341 / 8e-112 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Lus10009631 87 / 9e-21 AT4G21390 343 / 2e-115 S-locus lectin protein kinase family protein (.1)
Lus10018381 56 / 9e-10 AT4G23180 283 / 3e-91 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Lus10018382 54 / 4e-09 AT4G21410 605 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Lus10007632 54 / 5e-09 AT4G05200 624 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10025242 52 / 8e-09 AT1G11340 162 / 1e-46 S-locus lectin protein kinase family protein (.1)
Lus10005137 52 / 2e-08 AT1G11340 225 / 1e-68 S-locus lectin protein kinase family protein (.1)
Lus10007633 52 / 3e-08 AT4G05200 566 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10007602 51 / 6e-08 AT1G65800 788 / 0.0 receptor kinase 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G055500 92 / 2e-22 AT4G23180 364 / 2e-120 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.011G028700 57 / 5e-10 AT4G21410 460 / 4e-152 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Potri.004G026200 56 / 1e-09 AT4G05200 573 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.004G025425 56 / 1e-09 AT4G21410 556 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Potri.011G029800 55 / 2e-09 AT4G23220 568 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 14 (.1)
Potri.011G029100 55 / 3e-09 AT4G23220 570 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 14 (.1)
Potri.004G026350 54 / 5e-09 AT4G21410 610 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Potri.004G023550 54 / 5e-09 AT4G05200 541 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.004G028466 53 / 1e-08 AT1G11340 884 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.011G037100 52 / 2e-08 AT4G21380 982 / 0.0 receptor kinase 3 (.1)
PFAM info
Representative CDS sequence
>Lus10027229 pacid=23145451 polypeptide=Lus10027229 locus=Lus10027229.g ID=Lus10027229.BGIv1.0 annot-version=v1.0
ATGTGCATTCAAATAGCGCTTCTATGCTGCCAGGAGACCGTGTTCGATAGGCCGGACATGAACTCGGTTAACCTCATGCTCTCGAGCGACTCGTTTACCT
TGCCCGAACCGGGTAAGCCAGGAATGCAAGGCAGGGTAGTAAGATGGACGACTACCACCACCACCGAGGGAACCACGTCGGGTTTGACTAACGCTGGCAC
AACGAGGCCCGGTGGTGTCACCGGAGGGAACAACAGTTATTCTTCCCGCAACTCCATCTCTGTTTCCTCCATTGATGAAGCCATTACTGCTACAGTTACT
ACTGCCAGCTTATCCCGAGTTTCTATATCTCTTCAAACATACTATGGAGGTGAAGCTATGGAGCGAGAGCGAGAGATGTATGAGAACTTTGAGGAGCTCT
ACGCAATAATCAAGGCCACTGAGAAGCTCGAGAAGGCTTAG
AA sequence
>Lus10027229 pacid=23145451 polypeptide=Lus10027229 locus=Lus10027229.g ID=Lus10027229.BGIv1.0 annot-version=v1.0
MCIQIALLCCQETVFDRPDMNSVNLMLSSDSFTLPEPGKPGMQGRVVRWTTTTTTEGTTSGLTNAGTTRPGGVTGGNNSYSSRNSISVSSIDEAITATVT
TASLSRVSISLQTYYGGEAMEREREMYENFEELYAIIKATEKLEKA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G21380 ARK3 receptor kinase 3 (.1) Lus10027229 0 1
AT2G37480 unknown protein Lus10025314 3.7 0.8983
AT5G61540 N-terminal nucleophile aminohy... Lus10009560 6.3 0.8968
AT3G10260 Reticulon family protein (.1.2... Lus10020718 17.0 0.8712
AT4G32180 ATPANK2 pantothenate kinase 2 (.1.2.3) Lus10029146 19.3 0.8959
AT5G17680 disease resistance protein (TI... Lus10041078 22.6 0.8769
AT5G18640 alpha/beta-Hydrolases superfam... Lus10033968 26.3 0.8915
AT1G01720 NAC ATAF1, ANAC002 Arabidopsis NAC domain contain... Lus10025690 26.5 0.8819
AT1G74100 SOT16, ATSOT16,... CORONATINE INDUCED-7, ARABIDOP... Lus10031621 28.6 0.8925
AT4G36730 bZIP GBF1 G-box binding factor 1 (.1.2) Lus10014324 31.7 0.8521
AT2G17930 Phosphatidylinositol 3- and 4-... Lus10041911 38.4 0.8479

Lus10027229 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.