Lus10027231 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G15220 212 / 2e-71 ATCCMH cytochrome c biogenesis protein family (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038941 332 / 6e-119 AT1G15220 212 / 2e-71 cytochrome c biogenesis protein family (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G052000 241 / 4e-83 AT1G15220 216 / 8e-73 cytochrome c biogenesis protein family (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03918 CcmH Cytochrome C biogenesis protein
Representative CDS sequence
>Lus10027231 pacid=23145408 polypeptide=Lus10027231 locus=Lus10027231.g ID=Lus10027231.BGIv1.0 annot-version=v1.0
ATGGAGAACAAAAGCGATGATGAAGTTAAGAACTCGCGAATTATGGAGGCTCGTGCCAGAAACATTAGTCACAATGTCAGGTGCACCGAGTGTGGGAGTC
AGTCCATTGAAGATTCTCAAGCTGACATTGCCGTTCTCCTCAGGAAGTTGATCCGTGAGGAGGTCCAGGCTGGAAAATCCGACAAAGAGATCTTCAAGAA
GCTAGAGGATGAATTCGGAGAGACGGTTCTCTACGCACCGAAGTTCGATTGGCAAACTGCCGGGATATGGCTATCACCACTTTTGATTGTAGGTACTGCT
GGAGGGATATGGGCTTACGGAAAGCACAGGCAGAATACCAATGTGCATATCATGGCACTAAATCTCGTGAGGGGCGTTACTCTAACGCCGAAAGAGAAGG
AGACTATGCTGGAGATTCTAACGCCTCCTCCCCCACAACGAGCCCCTCTTCTTCTGTCCTGGTGGAGGAAAATGATAACGTGA
AA sequence
>Lus10027231 pacid=23145408 polypeptide=Lus10027231 locus=Lus10027231.g ID=Lus10027231.BGIv1.0 annot-version=v1.0
MENKSDDEVKNSRIMEARARNISHNVRCTECGSQSIEDSQADIAVLLRKLIREEVQAGKSDKEIFKKLEDEFGETVLYAPKFDWQTAGIWLSPLLIVGTA
GGIWAYGKHRQNTNVHIMALNLVRGVTLTPKEKETMLEILTPPPPQRAPLLLSWWRKMIT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G15220 ATCCMH cytochrome c biogenesis protei... Lus10027231 0 1
AT1G05600 EMB3101 EMBRYO DEFECTIVE 3101, Tetratr... Lus10002682 10.7 0.7428
AT5G63460 SAP domain-containing protein ... Lus10022457 15.3 0.8068
AT1G55170 unknown protein Lus10041450 15.5 0.7487
AT4G34020 AtDJ1C DJ-1 homolog C, Class I glutam... Lus10014067 28.2 0.7866
AT3G56720 unknown protein Lus10038984 29.1 0.7947
AT1G13570 F-box/RNI-like superfamily pro... Lus10029077 30.5 0.7460
AT4G33540 metallo-beta-lactamase family ... Lus10008550 31.3 0.7946
AT4G31040 CemA-like proton extrusion pro... Lus10021616 37.4 0.7742
AT1G14990 unknown protein Lus10035021 43.7 0.7234
AT1G69630 F-box/RNI-like superfamily pro... Lus10006318 47.0 0.7174

Lus10027231 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.