Lus10027232 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G18295 55 / 8e-10 Protein of unknown function (DUF1639) (.1)
AT1G25370 52 / 7e-09 Protein of unknown function (DUF1639) (.1)
AT4G17440 48 / 3e-07 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2)
AT1G68340 48 / 3e-07 Protein of unknown function (DUF1639) (.1)
AT3G60410 47 / 7e-07 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2), Protein of unknown function (DUF1639) (.3)
AT1G48770 45 / 2e-06 Protein of unknown function (DUF1639) (.1)
AT4G20300 40 / 0.0001 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2)
AT1G55340 38 / 0.001 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038942 102 / 7e-30 AT1G25370 72 / 7e-17 Protein of unknown function (DUF1639) (.1)
Lus10035144 52 / 2e-08 AT1G25370 87 / 2e-20 Protein of unknown function (DUF1639) (.1)
Lus10010984 46 / 2e-06 AT3G60410 89 / 3e-20 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2), Protein of unknown function (DUF1639) (.3)
Lus10004378 45 / 4e-06 AT4G17440 96 / 4e-23 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2)
Lus10010312 38 / 0.0007 AT1G55340 254 / 1e-86 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G122700 67 / 4e-14 AT1G25370 110 / 1e-28 Protein of unknown function (DUF1639) (.1)
Potri.008G122600 66 / 8e-14 AT1G25370 100 / 6e-25 Protein of unknown function (DUF1639) (.1)
Potri.012G055200 60 / 1e-11 AT3G18295 109 / 3e-29 Protein of unknown function (DUF1639) (.1)
Potri.002G136200 54 / 3e-09 AT3G60410 109 / 6e-28 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2), Protein of unknown function (DUF1639) (.3)
Potri.014G044800 50 / 5e-08 AT3G60410 105 / 6e-26 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2), Protein of unknown function (DUF1639) (.3)
Potri.013G057600 39 / 0.0004 AT1G55340 212 / 1e-69 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2)
Potri.003G157500 39 / 0.0007 AT4G20300 201 / 2e-61 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2)
Potri.019G035300 38 / 0.0009 AT1G55340 232 / 9e-78 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07797 DUF1639 Protein of unknown function (DUF1639)
Representative CDS sequence
>Lus10027232 pacid=23145397 polypeptide=Lus10027232 locus=Lus10027232.g ID=Lus10027232.BGIv1.0 annot-version=v1.0
ATGGGGAACCCAGCGAGTCCTCCGCTGCGTCAAAATCCCTCCTCCTCCTCCTCCCCCGCCGCCTCATCATCATCACCACCACCGGCACTCATCCGTCGTC
GAGGAGGAGGAGGAGCATTTTGGGAGATTGAGTCTTCTCCGGCGGCGAAGAGGCAGTGTTTGGAGTCTCCGCCGCCACTATCGATGAATGGAAAAGTCAA
CAACATGAAGCTGTGTGTTCCGCTGACCAGGGATGAGATTGAAGAAGATTTCATGGAGATTGCCAGGATGAGACCCCCCAGGAGACCCAAGAAGCGGCCC
AGAATTGTTCAGAAGTATATGGATTTAATGTTCCCAGGGCTATGGATAACTGAAGTCACAACAGATCTATACAAAGTTCCTGAAGTACAGGAATCATGA
AA sequence
>Lus10027232 pacid=23145397 polypeptide=Lus10027232 locus=Lus10027232.g ID=Lus10027232.BGIv1.0 annot-version=v1.0
MGNPASPPLRQNPSSSSSPAASSSSPPPALIRRRGGGGAFWEIESSPAAKRQCLESPPPLSMNGKVNNMKLCVPLTRDEIEEDFMEIARMRPPRRPKKRP
RIVQKYMDLMFPGLWITEVTTDLYKVPEVQES

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G68340 Protein of unknown function (D... Lus10027232 0 1
AT4G37290 unknown protein Lus10010255 7.7 0.9808
AT3G26770 NAD(P)-binding Rossmann-fold s... Lus10032192 11.8 0.9796
AT5G37490 ARM repeat superfamily protein... Lus10001079 14.9 0.9795
AT4G37290 unknown protein Lus10019310 16.2 0.9787
AT3G12500 PR-3, PR3, CHI-... PATHOGENESIS-RELATED 3, basic ... Lus10028377 18.6 0.9786
AT3G24550 ATPERK1 proline-rich extensin-like rec... Lus10043219 19.9 0.9517
AT3G05200 ATL6 RING/U-box superfamily protein... Lus10000333 21.9 0.9783
AT4G36810 GGPS1 geranylgeranyl pyrophosphate s... Lus10017624 22.0 0.9779
AT2G47140 AtSDR5 short-chain dehydrogenase redu... Lus10021311 22.9 0.9760
AT1G14590 Nucleotide-diphospho-sugar tra... Lus10041973 24.2 0.9776

Lus10027232 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.