Lus10027237 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G18580 246 / 5e-83 Nucleic acid-binding, OB-fold-like protein (.1)
AT4G11060 100 / 7e-26 MTSSB mitochondrially targeted single-stranded DNA binding protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038946 296 / 8e-103 AT3G18580 243 / 7e-82 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10031482 103 / 4e-26 AT4G11060 277 / 4e-94 mitochondrially targeted single-stranded DNA binding protein (.1)
Lus10015200 94 / 1e-23 AT4G11060 202 / 2e-66 mitochondrially targeted single-stranded DNA binding protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G058800 234 / 6e-78 AT3G18580 261 / 2e-88 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.013G011800 97 / 9e-25 AT4G11060 279 / 2e-96 mitochondrially targeted single-stranded DNA binding protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0021 OB PF00436 SSB Single-strand binding protein family
Representative CDS sequence
>Lus10027237 pacid=23145484 polypeptide=Lus10027237 locus=Lus10027237.g ID=Lus10027237.BGIv1.0 annot-version=v1.0
ATGGCGGCAACTTCGATCGCAACCATTTCCCGCAGGCTCTCCCGCTCCATTCTCTCAAACCATAACATCCCTCACGCTTCCGTCCCCTTCTGCACAACCA
CTGCCTCATCTCCCGAGGTCGACCCGGACTCCATCAACCCAGACGCCGATCCAATCCCCAGCTCCGCCGCCGCTGCCGACTCACCACCATCAACACCGCG
TCCCAATTCCAACGAACGCGTCGTGTACGATCGCCCGCTCGAGGATGGGCTTGACATCGGCGTATACAAGGCGATACTTGTGGGGCAAGTGGGGCAGAGT
CCGTTTCAGAAGAAGCTGAAAGGCGGGAGAACGGTGACTTTGCTGTCTGTGGGAACTGGAGGGATTCGGAATAATCGAAGGCCGTTGGAGAATGAGGAGC
CGAGGGATTATGCGAATCGGTGTGCTATTCAGTGGCATCGTGTATCTGTCTACCCGGAGAGATTGGGTGATCTTGTGATGAAGGAAGTTGTTCCCGGGTC
GAATGTCTATCTGGAAGGGAACCTGGAGACAAAAATATTTACTGATCCAGTTACTGGCCTCGTGCGGCGTGTAAGAGAGATTGCTATTCGTGGCAATGGC
CGAATCGTGTCGTTGGGAGGCGATGGCGCCACCCCTGGAGCTTCAGGGTTGAAAGGAGTTGGCTATTACTAG
AA sequence
>Lus10027237 pacid=23145484 polypeptide=Lus10027237 locus=Lus10027237.g ID=Lus10027237.BGIv1.0 annot-version=v1.0
MAATSIATISRRLSRSILSNHNIPHASVPFCTTTASSPEVDPDSINPDADPIPSSAAAADSPPSTPRPNSNERVVYDRPLEDGLDIGVYKAILVGQVGQS
PFQKKLKGGRTVTLLSVGTGGIRNNRRPLENEEPRDYANRCAIQWHRVSVYPERLGDLVMKEVVPGSNVYLEGNLETKIFTDPVTGLVRRVREIAIRGNG
RIVSLGGDGATPGASGLKGVGYY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G18580 Nucleic acid-binding, OB-fold-... Lus10027237 0 1
AT3G18600 P-loop containing nucleoside t... Lus10027240 2.0 0.9191
AT3G18600 P-loop containing nucleoside t... Lus10038950 3.9 0.9002
AT1G74050 Ribosomal protein L6 family pr... Lus10038775 6.0 0.9117
AT5G44500 Small nuclear ribonucleoprotei... Lus10038421 6.3 0.9067
AT3G48250 BIR6 Buthionine sulfoximine-insensi... Lus10019474 6.7 0.8912
AT5G41970 Metal-dependent protein hydrol... Lus10000877 7.7 0.8967
AT5G48760 Ribosomal protein L13 family p... Lus10007137 8.1 0.9108
AT4G27490 3'-5'-exoribonuclease family p... Lus10037395 8.5 0.8868
AT1G70600 Ribosomal protein L18e/L15 sup... Lus10006207 9.9 0.8937
AT5G41970 Metal-dependent protein hydrol... Lus10033229 11.2 0.8829

Lus10027237 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.