Lus10027246 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G18170 186 / 4e-59 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT1G73655 174 / 1e-54 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT4G19830 55 / 4e-09 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT3G10060 55 / 5e-09 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT4G26555 54 / 9e-09 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT5G13410 49 / 1e-06 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT1G20810 44 / 2e-05 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT3G60370 43 / 5e-05 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT2G43560 42 / 0.0002 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038954 359 / 1e-127 AT1G18170 193 / 1e-61 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10031342 163 / 1e-50 AT1G18170 261 / 3e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10038345 57 / 7e-10 AT4G19830 262 / 3e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10036206 56 / 8e-10 AT4G19830 260 / 4e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10035560 50 / 3e-07 AT3G10060 296 / 2e-102 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10006949 49 / 8e-07 AT5G45680 244 / 2e-82 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1)
Lus10042897 49 / 8e-07 AT3G60370 312 / 8e-109 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10028194 47 / 6e-06 AT3G60370 305 / 2e-104 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10009062 45 / 2e-05 AT1G73660 673 / 0.0 protein tyrosine kinase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G048300 177 / 2e-55 AT1G18170 249 / 3e-83 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.012G119800 58 / 4e-10 AT4G19830 270 / 5e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.016G096600 50 / 3e-07 AT3G10060 272 / 6e-93 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.014G045600 50 / 4e-07 AT3G60370 302 / 3e-104 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.001G075500 48 / 9e-07 AT5G45680 253 / 7e-86 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1)
Potri.001G068300 48 / 2e-06 AT5G13410 332 / 4e-116 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0487 FKBP PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence
>Lus10027246 pacid=23145433 polypeptide=Lus10027246 locus=Lus10027246.g ID=Lus10027246.BGIv1.0 annot-version=v1.0
ATGACGACGATGAAGATAACTCCATCCATGATAACAGGAGGAAGACAGCAGCAGCCATTACTAAGCCAACCCTTCACTGCAACAAGAACAAGTTCAAGAA
GCTTCAGCAGCATCAGTTGCTCACTTCAAACACAGAAGCTAATGATGACAGATTCGTCTGATGGCTTGACACGGAGATTCGGACTAGGAGCAGCAGGAAT
CTCTTGGGCAGCTTTTCTAGTTTCTCAGAAGAAGACCAAAGACACCAGAGACATGGAGAAGGGAGGAGTAGTGGTTTTGCCAAATGGAATACGGTACTAT
GATATGGAGATAGGAACAGGGGAATGTCCAAGGGCAGGAGACTTGGTGGTGATGAATCTAAAGGGGAATGTAGTTGGAGGGAAAGACGGGGTAACGATTG
TCGACACATTCGAAGGAACGAAGAAGAAGAAGCCGATGGCTATGGTGGTAATGGGTTCAAGGCCATATAGTAAAGGGATGTGTGAAGGGATAGAGCATGT
GGTGAGATCAATGAAGGCTGGTGGTGTAAGAAGGGTTATTGTACCTCCTAGCTTCGGATTCGGTGTCCATGGTGCCGATTTCGGGTCTTTGAACATCCCA
CCTTCTTCAACTCTTGAGTACATTGTTGAGGTTCACAGTGTCTCCACCCCAGCTGCATAA
AA sequence
>Lus10027246 pacid=23145433 polypeptide=Lus10027246 locus=Lus10027246.g ID=Lus10027246.BGIv1.0 annot-version=v1.0
MTTMKITPSMITGGRQQQPLLSQPFTATRTSSRSFSSISCSLQTQKLMMTDSSDGLTRRFGLGAAGISWAAFLVSQKKTKDTRDMEKGGVVVLPNGIRYY
DMEIGTGECPRAGDLVVMNLKGNVVGGKDGVTIVDTFEGTKKKKPMAMVVMGSRPYSKGMCEGIEHVVRSMKAGGVRRVIVPPSFGFGVHGADFGSLNIP
PSSTLEYIVEVHSVSTPAA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G18170 FKBP-like peptidyl-prolyl cis-... Lus10027246 0 1
AT1G07700 Thioredoxin superfamily protei... Lus10032343 1.0 0.9648
AT1G79040 PSBR photosystem II subunit R (.1) Lus10042461 3.2 0.9617
AT1G12250 Pentapeptide repeat-containing... Lus10024602 3.9 0.9526
AT1G79040 PSBR photosystem II subunit R (.1) Lus10026205 6.7 0.9584
AT2G46820 PSI-P, TMP14, P... THYLAKOID MEMBRANE PHOSPHOPROT... Lus10002673 6.9 0.9541
AT1G32470 Single hybrid motif superfamil... Lus10035374 7.7 0.9444
AT2G42190 unknown protein Lus10031232 8.9 0.8987
AT4G22950 MADS AGL19 AGAMOUS-like 19 (.1) Lus10014143 9.3 0.9277
AT1G64355 unknown protein Lus10001903 10.9 0.9107
AT4G12830 alpha/beta-Hydrolases superfam... Lus10008747 11.2 0.9494

Lus10027246 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.