Lus10027262 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10027262 pacid=23145546 polypeptide=Lus10027262 locus=Lus10027262.g ID=Lus10027262.BGIv1.0 annot-version=v1.0
ATGGTTTTATCAGCTATATTAGTTCAGCCTTGCTTCTCAACGTCCATGAACCAGAAATGCACGTCTGGTGCGTCTAGCAGAGGCATAACACTAAGCAGTT
CTTGTCGAAGTTGTATGGAGATTCAACCAAGCGCCCTACTGTCAAGTCCTGGTTGCCCTGCCGGGTTAAACGGTGTTAATCCGCACGACAACCGTCTTGG
TGGGTTTTGGACTGAAGAAAAGAAGACACTGTACAAAGTTGCAGCGAAACCGGTTGTTGGAGTTTATGAGGCCCGAGGGCATAGATTCACTTGTGACTGC
GTACAGAACGAGGCAGTAGCTCATACGATACGATGA
AA sequence
>Lus10027262 pacid=23145546 polypeptide=Lus10027262 locus=Lus10027262.g ID=Lus10027262.BGIv1.0 annot-version=v1.0
MVLSAILVQPCFSTSMNQKCTSGASSRGITLSSSCRSCMEIQPSALLSSPGCPAGLNGVNPHDNRLGGFWTEEKKTLYKVAAKPVVGVYEARGHRFTCDC
VQNEAVAHTIR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10027262 0 1
AT4G34020 AtDJ1C DJ-1 homolog C, Class I glutam... Lus10014067 11.0 0.8123
AT2G34730 myosin heavy chain-related (.1... Lus10023264 13.4 0.8127
AT1G67390 F-box family protein (.1) Lus10013664 15.9 0.8086
AT5G09225 unknown protein Lus10033507 18.7 0.6934
AT4G31580 SRZ22, RSZP22, ... RS-containing zinc finger prot... Lus10020123 24.3 0.7650
AT5G10620 methyltransferases (.1) Lus10026980 30.5 0.7860
AT5G17070 unknown protein Lus10008757 32.1 0.7728
AT5G18570 EMB3138, ATOBGL... EMBRYO DEFECTIVE 3138, EMBRYO ... Lus10006128 44.0 0.7589
AT3G52120 SWAP (Suppressor-of-White-APri... Lus10037485 44.7 0.7730
AT4G01310 Ribosomal L5P family protein (... Lus10010251 48.3 0.7578

Lus10027262 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.