Lus10027265 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G10190 130 / 2e-36 Major facilitator superfamily protein (.1)
AT1G78130 126 / 3e-35 UNE2 unfertilized embryo sac 2, Major facilitator superfamily protein (.1)
AT4G36790 65 / 4e-13 Major facilitator superfamily protein (.1)
AT2G18590 64 / 1e-12 Major facilitator superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038972 166 / 5e-50 AT5G10190 720 / 0.0 Major facilitator superfamily protein (.1)
Lus10041712 69 / 2e-14 AT4G36790 663 / 0.0 Major facilitator superfamily protein (.1)
Lus10026037 68 / 4e-14 AT4G36790 639 / 0.0 Major facilitator superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G091800 124 / 3e-34 AT5G10190 643 / 0.0 Major facilitator superfamily protein (.1)
Potri.007G091700 110 / 3e-29 AT5G10190 660 / 0.0 Major facilitator superfamily protein (.1)
Potri.007G030800 74 / 5e-16 AT4G36790 633 / 0.0 Major facilitator superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10027265 pacid=23145405 polypeptide=Lus10027265 locus=Lus10027265.g ID=Lus10027265.BGIv1.0 annot-version=v1.0
ATGACGCTGTTCACTGTCGCGATCTCCATTGGCGGTCTGTTCGGAGGGAAAATGGGAGACACTCTTGCTAAACGGTTCCCGAATTCCGGAAGGATCGTTC
TTTCTCAAATAAGCTCCGGTTCGGCCATTCCTTTAGCTGCTTTTCTGCTGCTGGTACTGCCTGATGATCCCTCGACAGGTTTCATGCACGGTCTGGTCTT
GTTCATCATGGGGCTGTCAATTTCGTGGAACAGTCCCGCCATAAACAACGATGATGATGATGAAGACGGTAAAATTGTGGAAGAAGATGGACGGGCCGTC
GTTGAGATTGAGTACGGGAAAGATGAAGAGAGTGTTGGGTTGGATGATGGTGATGATAAGGCTTTGCTTTCTGGTGATCAGCTTTCTGAGTTGGATCATA
GATGA
AA sequence
>Lus10027265 pacid=23145405 polypeptide=Lus10027265 locus=Lus10027265.g ID=Lus10027265.BGIv1.0 annot-version=v1.0
MTLFTVAISIGGLFGGKMGDTLAKRFPNSGRIVLSQISSGSAIPLAAFLLLVLPDDPSTGFMHGLVLFIMGLSISWNSPAINNDDDDEDGKIVEEDGRAV
VEIEYGKDEESVGLDDGDDKALLSGDQLSELDHR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G10190 Major facilitator superfamily ... Lus10027265 0 1
AT1G01490 Heavy metal transport/detoxifi... Lus10027524 3.0 0.8000
AT5G63800 MUM2, BGAL6 MUCILAGE-MODIFIED 2, beta-gala... Lus10033500 5.8 0.7932
AT5G66030 ATGRIP, GRIP Golgi-localized GRIP domain-co... Lus10010676 9.2 0.7654
AT1G13570 F-box/RNI-like superfamily pro... Lus10028368 9.5 0.7322
AT3G56710 SIB1 sigma factor binding protein 1... Lus10039494 11.0 0.7744
AT2G23460 ATXLG1, XLG1 extra-large G-protein 1 (.1) Lus10023838 11.1 0.7771
AT4G03420 Protein of unknown function (D... Lus10031632 14.7 0.6924
AT1G24110 Peroxidase superfamily protein... Lus10029201 16.0 0.7553
AT1G47480 alpha/beta-Hydrolases superfam... Lus10034068 16.4 0.7497
AT5G39590 TLD-domain containing nucleola... Lus10012406 19.4 0.7276

Lus10027265 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.