Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53820 81 / 4e-22 Late embryogenesis abundant protein (LEA) family protein (.1) AT5G38760 81 / 4e-22 Late embryogenesis abundant protein (LEA) family protein (.1) AT3G02480 64 / 2e-15 Late embryogenesis abundant protein (LEA) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039004 [exp] 120 / 5e-38 AT5G53820 78 / 5e-21 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10010451 [exp] 105 / 5e-32 AT5G38760 83 / 3e-23 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10007566 [exp] 97 / 1e-28 AT5G53820 80 / 8e-22 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10034081 [exp] 92 / 1e-26 AT5G38760 80 / 9e-22 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10012179 [exp] 91 / 5e-26 AT5G38760 74 / 2e-19 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10003056 [exp] 89 / 1e-25 AT5G53820 74 / 2e-19 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10034100 [exp] 86 / 3e-24 AT5G38760 89 / 2e-25 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10003046 [exp] 82 / 1e-22 AT5G38760 82 / 1e-22 Late embryogenesis abundant protein (LEA) family protein (.1) Lus10026292 [exp] 67 / 6e-17 AT5G38760 65 / 4e-16 Late embryogenesis abundant protein (LEA) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G107600 [exp] 78 / 4e-21 AT5G38760 90 / 8e-26 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.017G108400 [exp] 75 / 8e-20 AT5G38760 97 / 2e-28 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107800 [exp] 74 / 1e-19 AT5G38760 98 / 5e-29 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107900 [exp] 74 / 1e-19 AT5G38760 98 / 5e-29 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107100 [exp] 74 / 1e-19 AT5G38760 98 / 5e-29 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107500 [exp] 73 / 4e-19 AT5G38760 97 / 1e-28 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.017G108300 [exp] 72 / 9e-19 AT5G38760 96 / 3e-28 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.017G108350 [exp] 72 / 9e-19 AT5G38760 96 / 3e-28 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G106350 [exp] 68 / 3e-17 AT5G53820 42 / 9e-07 Late embryogenesis abundant protein (LEA) family protein (.1) Potri.004G107700 [exp] 63 / 2e-15 AT5G53820 75 / 6e-20 Late embryogenesis abundant protein (LEA) family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027298 pacid=23145448 polypeptide=Lus10027298 locus=Lus10027298.g ID=Lus10027298.BGIv1.0 annot-version=v1.0 ATGAATAACTCTCAGGATGCCAGTTACCAGGCGGGCCAAGCTAAAGGCCAAGTTCAGGAAAAAGCAAGTGGCATGATGGACAAAGCTAGTAATGCTGCTC AATCGACAAAAGAATCCATGCAAGATGCTGGTTCTCAAATGCAAGCTAAAGCACAAGAGGCTTCGGAGGCTACCAAAGAGAAGCTTGGAATGAATAAATA G
AA sequence Show only first row Show all	>Lus10027298 pacid=23145448 polypeptide=Lus10027298 locus=Lus10027298.g ID=Lus10027298.BGIv1.0 annot-version=v1.0 MNNSQDASYQAGQAKGQVQEKASGMMDKASNAAQSTKESMQDAGSQMQAKAQEASEATKEKLGMNK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G53820			Late embryogenesis abundant pr...		Lus10027298 [exp]	0	1

Compare expression of checked genes

Lus10027298 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.