Lus10027312 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22260 286 / 2e-97 Cysteine proteinases superfamily protein (.1.2.3)
AT3G02070 244 / 3e-81 Cysteine proteinases superfamily protein (.1)
AT5G04250 202 / 4e-63 Cysteine proteinases superfamily protein (.1.2)
AT5G03330 197 / 4e-61 Cysteine proteinases superfamily protein (.1.2)
AT2G39320 91 / 5e-22 Cysteine proteinases superfamily protein (.1)
AT5G67170 60 / 4e-10 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010459 335 / 4e-117 AT3G22260 338 / 7e-119 Cysteine proteinases superfamily protein (.1.2.3)
Lus10003816 285 / 2e-97 AT3G22260 298 / 2e-103 Cysteine proteinases superfamily protein (.1.2.3)
Lus10038708 203 / 2e-63 AT5G04250 367 / 2e-126 Cysteine proteinases superfamily protein (.1.2)
Lus10026525 199 / 4e-62 AT5G03330 292 / 4e-97 Cysteine proteinases superfamily protein (.1.2)
Lus10037977 197 / 6e-61 AT5G04250 361 / 5e-124 Cysteine proteinases superfamily protein (.1.2)
Lus10013813 192 / 4e-59 AT5G03330 280 / 2e-92 Cysteine proteinases superfamily protein (.1.2)
Lus10001404 190 / 2e-58 AT5G03330 327 / 9e-111 Cysteine proteinases superfamily protein (.1.2)
Lus10023019 189 / 6e-58 AT5G03330 325 / 4e-110 Cysteine proteinases superfamily protein (.1.2)
Lus10037388 174 / 1e-52 AT5G04250 239 / 6e-77 Cysteine proteinases superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G019700 313 / 2e-108 AT3G22260 333 / 5e-117 Cysteine proteinases superfamily protein (.1.2.3)
Potri.006G021700 311 / 9e-108 AT3G22260 347 / 2e-122 Cysteine proteinases superfamily protein (.1.2.3)
Potri.014G140200 246 / 5e-82 AT3G02070 358 / 2e-127 Cysteine proteinases superfamily protein (.1)
Potri.016G094700 204 / 3e-64 AT5G03330 316 / 9e-107 Cysteine proteinases superfamily protein (.1.2)
Potri.006G125900 202 / 5e-63 AT5G03330 329 / 1e-111 Cysteine proteinases superfamily protein (.1.2)
Potri.010G225400 199 / 2e-61 AT5G04250 360 / 2e-123 Cysteine proteinases superfamily protein (.1.2)
Potri.008G036700 197 / 9e-61 AT5G04250 372 / 2e-128 Cysteine proteinases superfamily protein (.1.2)
Potri.008G036900 175 / 1e-54 AT5G04250 239 / 4e-79 Cysteine proteinases superfamily protein (.1.2)
Potri.005G140500 69 / 3e-13 AT5G67170 401 / 3e-139 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Potri.004G196800 45 / 3e-05 AT2G27350 458 / 3e-157 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02338 OTU OTU-like cysteine protease
Representative CDS sequence
>Lus10027312 pacid=23145436 polypeptide=Lus10027312 locus=Lus10027312.g ID=Lus10027312.BGIv1.0 annot-version=v1.0
ATGACTGAAAGCTATAACAATGCAAGTACAAGCTCGGCTTCGAGTTATAATAGCAGCAGTATTCCCGATACAGAGGATGATAAGGTTATTGCGAGTATCC
TAGCTGAAGATGAAAAAGCTAACGCTGGCAGACAGCTTGGAAAGAGACTCTCTCACTTGGATTCTATACCTCACACTCCTCGGGTTAATGGTCAAATTCC
AGATGTGAATGATGCAAGCTTTGATCATGTTCGGTTGTCTGAAAGGTTGAGGACATATGGGCTAGCGGAACTGCATATGGAGGGTGATGGGAATTGTCAG
TTTCGAGCACTAGCAGACCAGCTACTTCGCAGTCCAGATTATCACAAACATGTAAGGAAGCAAGTGATCAAGCAGCTAAAGCACTCTAGAAAACTATATG
AAGGTTATATCCCGATGAAGTACAGAAGATACATAAAAAGGATGAAGAAGTACGAGTTTTGGCGTGACATGTCTTTATCAGGAGAATGGGGTGATCACGT
AACTTTGCAAGCTGCAGCAGATCGATTTGAAGTAAAAATCTGCTTGGTCACATCTTTCCGGGACACATGCTACATCGAGATCAGGCCCAAAGACAAAAAT
CCTAGCAGAGAGATTTGGTTGAGCTTCTGGAGTGAAGTTCACTACAACTCGCTATATACAGTCGGAGGTAACGAAACAATAAACAAATCCAACAACTCAC
TGAAACGTTTATCTGGCATTTTGAGACCTTTATACAATCTGAATCTGATGATATCCATTTCGTCAAACCATGTGCTGCAGATATTCCTCACCGAGTACCC
AGGAAAAAGCATTGGCTCTTCTGATGTCGAATCTCGCAACCCCAAACCATAA
AA sequence
>Lus10027312 pacid=23145436 polypeptide=Lus10027312 locus=Lus10027312.g ID=Lus10027312.BGIv1.0 annot-version=v1.0
MTESYNNASTSSASSYNSSSIPDTEDDKVIASILAEDEKANAGRQLGKRLSHLDSIPHTPRVNGQIPDVNDASFDHVRLSERLRTYGLAELHMEGDGNCQ
FRALADQLLRSPDYHKHVRKQVIKQLKHSRKLYEGYIPMKYRRYIKRMKKYEFWRDMSLSGEWGDHVTLQAAADRFEVKICLVTSFRDTCYIEIRPKDKN
PSREIWLSFWSEVHYNSLYTVGGNETINKSNNSLKRLSGILRPLYNLNLMISISSNHVLQIFLTEYPGKSIGSSDVESRNPKP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G22260 Cysteine proteinases superfami... Lus10027312 0 1
AT4G21760 BGLU47 beta-glucosidase 47 (.1) Lus10032660 1.7 0.8296
AT1G27170 transmembrane receptors;ATP bi... Lus10020533 6.2 0.8334
AT4G32440 Plant Tudor-like RNA-binding p... Lus10014715 6.9 0.8446
AT1G55320 AAE18 acyl-activating enzyme 18 (.1.... Lus10034997 8.7 0.8226
AT2G46060 transmembrane protein-related ... Lus10018827 8.8 0.7943
AT1G33811 GDSL-like Lipase/Acylhydrolase... Lus10036046 9.6 0.7340
AT3G09010 Protein kinase superfamily pro... Lus10002494 9.8 0.7890
AT5G38900 Thioredoxin superfamily protei... Lus10005083 11.8 0.7967
AT2G11520 CRCK3 calmodulin-binding receptor-li... Lus10028347 12.3 0.7990
AT5G42080 RSW9, DRP1A, AG... RADIAL SWELLING 9, DYNAMIN-REL... Lus10023073 17.9 0.7907

Lus10027312 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.