Lus10027314 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G15000 211 / 1e-71 Ribosomal L27e protein family (.1.2)
AT3G22230 208 / 7e-71 Ribosomal L27e protein family (.1)
AT2G32220 195 / 1e-65 Ribosomal L27e protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039017 237 / 4e-82 AT4G15000 232 / 3e-80 Ribosomal L27e protein family (.1.2)
Lus10003814 220 / 3e-75 AT4G15000 239 / 7e-83 Ribosomal L27e protein family (.1.2)
Lus10010461 219 / 8e-75 AT4G15000 236 / 7e-82 Ribosomal L27e protein family (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G019000 213 / 9e-73 AT4G15000 209 / 5e-71 Ribosomal L27e protein family (.1.2)
Potri.001G342500 211 / 1e-71 AT4G15000 210 / 2e-71 Ribosomal L27e protein family (.1.2)
Potri.006G021500 211 / 1e-71 AT4G15000 205 / 2e-69 Ribosomal L27e protein family (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01777 Ribosomal_L27e Ribosomal L27e protein family
CL0107 KOW PF00467 KOW KOW motif
Representative CDS sequence
>Lus10027314 pacid=23145489 polypeptide=Lus10027314 locus=Lus10027314.g ID=Lus10027314.BGIv1.0 annot-version=v1.0
ATGGTGAAGTTCTTGAAGACCCACAAGGCGGTGATCGTCCTCCAAGGCCGGTATGCTGGGAAGAAGGCGGTGATCGTAAAGAACTTCGACGACGGAGTTC
GCGACCGCGCTTACGGCCACTGTTTGGTTGCAGGGATCAAGAAGTACCCGGGAAAGGTTATCAGGAAGGATTCGGCCAGGAAGACTGCCAAGAAGTCCAG
AGTCAAGTGCTTCGTGAAGCTCGTGAACTACAGGCACTTAATGCCGACCAGGTACACTCTCGATGTGGACTTGAAGGACGCCGTATCCATCGAATCCCTG
GCGAGCAAGGAGAAGAAGGTAGCCGCTTGCAAGGACGCCAAGGCCAAGTTCGAGGAGAGGTTCAAGACCGGAAAGAACAGGTGGTTCTTTACCAAACTCA
GGTTCTAG
AA sequence
>Lus10027314 pacid=23145489 polypeptide=Lus10027314 locus=Lus10027314.g ID=Lus10027314.BGIv1.0 annot-version=v1.0
MVKFLKTHKAVIVLQGRYAGKKAVIVKNFDDGVRDRAYGHCLVAGIKKYPGKVIRKDSARKTAKKSRVKCFVKLVNYRHLMPTRYTLDVDLKDAVSIESL
ASKEKKVAACKDAKAKFEERFKTGKNRWFFTKLRF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G15000 Ribosomal L27e protein family ... Lus10027314 0 1
AT2G31610 Ribosomal protein S3 family pr... Lus10033442 1.0 0.9206
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10019881 2.8 0.8928
AT4G15000 Ribosomal L27e protein family ... Lus10039017 3.2 0.9062
AT2G03530 ATUPS2, UPS2 ARABIDOPSIS THALIANA UREIDE PE... Lus10036911 3.9 0.9003
AT1G30880 unknown protein Lus10001224 4.0 0.8670
AT1G09590 Translation protein SH3-like f... Lus10021079 4.9 0.8807
AT4G15000 Ribosomal L27e protein family ... Lus10010461 5.0 0.8907
AT3G10950 Zinc-binding ribosomal protein... Lus10006414 5.3 0.8720
AT1G80860 ATPLMT ARABIDOPSIS PHOSPHOLIPID N-MET... Lus10026087 5.5 0.8189
AT1G34030 Ribosomal protein S13/S18 fami... Lus10043405 6.2 0.8539

Lus10027314 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.