Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47550 59 / 2e-12 Cystatin/monellin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039104 [exp] 121 / 9e-37 AT5G47550 74 / 4e-18 Cystatin/monellin superfamily protein (.1) Lus10039023 [exp] 66 / 9e-14 AT5G47560 332 / 2e-112 tonoplast dicarboxylate transporter (.1) Lus10010495 [exp] 55 / 1e-10 AT5G47550 73 / 1e-17 Cystatin/monellin superfamily protein (.1) Lus10017567 [exp] 51 / 3e-09 AT5G47550 69 / 7e-16 Cystatin/monellin superfamily protein (.1) Lus10025748 [exp] 48 / 5e-08 ND 37 / 5e-04 Lus10034773 [exp] 41 / 2e-05 AT5G47550 65 / 1e-14 Cystatin/monellin superfamily protein (.1) Lus10002838 [exp] 41 / 7e-05 ND / Lus10033311 [exp] 38 / 0.0005 ND 59 / 6e-12
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G014500 [exp] 66 / 4e-15 AT5G47550 100 / 9e-29 Cystatin/monellin superfamily protein (.1) Potri.006G014700 [exp] 60 / 2e-12 AT5G47550 62 / 3e-13 Cystatin/monellin superfamily protein (.1) Potri.006G014600 [exp] 48 / 4e-08 AT5G47550 56 / 6e-11 Cystatin/monellin superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027320 pacid=23145482 polypeptide=Lus10027320 locus=Lus10027320.g ID=Lus10027320.BGIv1.0 annot-version=v1.0 ATGAATCCAATCACCTTTATAGTGATGATGATAACCATCGCCATCACCTTGCCGGCGGCTGAAGCTATTTTCGGAAGATGGCAGCCGATAAAAAACCTGA GGGACAAACATGTTGTTGAGATTGCTGAGTTCGCTGTGACGACTTATTACGGCCAGCCTCCTAGATTGGAATTGGAACTTGTAAGCGTGGATAAAGGTGA ATACCAAGCGGTAGTTGCAGGGATGAAGTACAAGCTTACGCTAGCTGCTATCCAGCACAACGGTAATCCAGCAGAAAAACATGGTGAGTATCTAGCAATT GTGTATGAGAATATTTATCAGTTAAAGAACCTGATCTCACTTACAAATATTACCAGTGAGAATATGTAA
AA sequence Show only first row Show all	>Lus10027320 pacid=23145482 polypeptide=Lus10027320 locus=Lus10027320.g ID=Lus10027320.BGIv1.0 annot-version=v1.0 MNPITFIVMMITIAITLPAAEAIFGRWQPIKNLRDKHVVEIAEFAVTTYYGQPPRLELELVSVDKGEYQAVVAGMKYKLTLAAIQHNGNPAEKHGEYLAI VYENIYQLKNLISLTNITSENM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G47550			Cystatin/monellin superfamily ...		Lus10027320 [exp]	0	1
AT2G31945			unknown protein		Lus10039201 [exp]	5.6	0.9064
AT5G13750		ZIFL1	zinc induced facilitator-like ...		Lus10033338 [exp]	15.0	0.8585
AT3G44190			FAD/NAD(P)-binding oxidoreduct...		Lus10001856 [exp]	17.0	0.8798
AT2G31945			unknown protein		Lus10013740 [exp]	21.2	0.8945
AT4G01870			tolB protein-related (.1)		Lus10038052 [exp]	28.2	0.8900
AT4G15560		AtCLA1, DXS, DX...	1-DEOXY-D-XYLULOSE 5-PHOSPHATE...		Lus10019991 [exp]	29.1	0.8887
AT3G18730		BRU1, MGO3, TSK	TONSOKU, MGOUN3, BRUSHY1, tetr...		Lus10035746 [exp]	29.5	0.7726
AT3G23770			O-Glycosyl hydrolases family 1...		Lus10008881 [exp]	30.4	0.8859
AT3G13600			calmodulin-binding family prot...		Lus10039178 [exp]	32.0	0.8660
					Lus10041755 [exp]	34.9	0.7829

Compare expression of checked genes

Lus10027320 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.