Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G06150 68 / 5e-15 CYC1BAT, CYCB1;2 cyclin B 1;2, Cyclin family protein (.1) AT3G11520 62 / 4e-13 CYC2, CYCB1;3 CYCLIN 2, CYCLIN B1;3 (.1) AT1G76310 48 / 8e-08 CYCB2;4 CYCLIN B2;4 (.1) AT2G26760 46 / 3e-07 CYCB1;4, CYC3 Cyclin B1;4 (.1) AT4G37490 42 / 8e-06 CYC1, CYCB1;1, CYCB1 CYCLIN 1, CYCLIN B1;1 (.1) AT2G17620 40 / 5e-05 CYCB2;1 Cyclin B2;1 (.1) AT4G35620 40 / 5e-05 CYCB2;2 Cyclin B2;2 (.1) AT1G20610 38 / 0.0002 CYCB2;3 Cyclin B2;3 (.1) AT1G80370 36 / 0.0008 CYCA2;4 Cyclin A2;4 (.1) AT1G15570 36 / 0.001 CYCA2;3 CYCLIN A2;3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039033 [exp] 117 / 9e-33 AT5G06150 436 / 1e-150 cyclin B 1;2, Cyclin family protein (.1) Lus10003800 [exp] 64 / 3e-13 AT5G06150 387 / 2e-131 cyclin B 1;2, Cyclin family protein (.1) Lus10036080 [exp] 53 / 1e-09 AT2G26760 405 / 2e-140 Cyclin B1;4 (.1) Lus10026803 [exp] 47 / 1e-07 AT2G26760 401 / 2e-138 Cyclin B1;4 (.1) Lus10012261 [exp] 46 / 4e-07 AT1G76310 501 / 8e-176 CYCLIN B2;4 (.1) Lus10016015 [exp] 45 / 1e-06 AT1G76310 559 / 0.0 CYCLIN B2;4 (.1) Lus10010483 [exp] 38 / 0.0002 AT5G06150 322 / 8e-107 cyclin B 1;2, Cyclin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G033000 [exp] 52 / 2e-09 AT5G06150 452 / 5e-157 cyclin B 1;2, Cyclin family protein (.1) Potri.006G035200 [exp] 51 / 4e-09 AT5G06150 408 / 7e-140 cyclin B 1;2, Cyclin family protein (.1) Potri.009G066600 [exp] 51 / 7e-09 AT2G26760 430 / 5e-150 Cyclin B1;4 (.1) Potri.001G272000 [exp] 48 / 6e-08 AT2G26760 434 / 1e-151 Cyclin B1;4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0065 [flax] [poplar] Cyclin PF02984 [flax] [poplar] Cyclin_C Cyclin, C-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10027330 pacid=23145360 polypeptide=Lus10027330 locus=Lus10027330.g ID=Lus10027330.BGIv1.0 annot-version=v1.0 ATGGCGGCGGCGGCGGTTTACGCGGCGAGGCTGGCTCTGATGAGGTCGCCGGCGTGGAACGCGGGGATGGAGTTTTACACTGGGTATAAAGAGGCGGAGG TTGTGGAGTATGGGAGGGCTTTGGCTGGGTTGCAGTTGAAAGTGAAGGAGAGTAAGCTGCAGACTGTGGTGAGGAAGTATTCCAGCTCGCTGAAGGGCTC CGTTGCTCTGGTTTCTCCGGCCAAGTCTCTGCTATTGGCTTGA
AA sequence Show only first row Show all	>Lus10027330 pacid=23145360 polypeptide=Lus10027330 locus=Lus10027330.g ID=Lus10027330.BGIv1.0 annot-version=v1.0 MAAAAVYAARLALMRSPAWNAGMEFYTGYKEAEVVEYGRALAGLQLKVKESKLQTVVRKYSSSLKGSVALVSPAKSLLLA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G06150		CYC1BAT, CYCB1;...	cyclin B 1;2, Cyclin family pr...		Lus10027330 [exp]	0	1
AT5G24330		SDG34, ATXR6	SET DOMAIN PROTEIN 34, ARABIDO...		Lus10016526 [exp]	10.1	0.8874
AT3G12870			unknown protein		Lus10031776 [exp]	14.7	0.8807
AT4G28230			unknown protein		Lus10039766 [exp]	15.7	0.8572
AT1G76540		CDKB2;1	cyclin-dependent kinase B2;1 (...		Lus10040593 [exp]	21.1	0.8742
AT5G23420		HMGB6	high-mobility group box 6 (.1....		Lus10041009 [exp]	21.4	0.8700
AT1G44900		ATMCM2, MCM2	MINICHROMOSOME MAINTENANCE 2, ...		Lus10009683 [exp]	24.7	0.8745
AT5G26330			Cupredoxin superfamily protein...		Lus10002451 [exp]	29.7	0.7667
AT3G27330			zinc finger (C3HC4-type RING f...		Lus10022324 [exp]	31.1	0.8740
AT5G23420		HMGB6	high-mobility group box 6 (.1....		Lus10013453 [exp]	37.5	0.8608
AT1G05440			C-8 sterol isomerases (.1)		Lus10041200 [exp]	37.5	0.8534

Compare expression of checked genes

Lus10027330 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.