Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G07250 62 / 8e-13 UGT71C4 UDP-glucosyl transferase 71C4 (.1) AT3G21780 58 / 2e-11 UGT71B6 UDP-glucosyl transferase 71B6 (.1) AT2G29750 57 / 6e-11 UGT71C1 UDP-glucosyl transferase 71C1 (.1) AT3G21760 56 / 1e-10 HYR1 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1) AT1G07260 55 / 3e-10 UGT71C3 UDP-glucosyl transferase 71C3 (.1) AT1G07240 52 / 3e-09 UGT71C5 UDP-glucosyl transferase 71C5 (.1) AT4G15280 51 / 8e-09 UGT71B5 UDP-glucosyl transferase 71B5 (.1) AT2G29730 50 / 1e-08 UGT71D1 UDP-glucosyl transferase 71D1 (.1) AT4G15260 49 / 5e-08 UDP-Glycosyltransferase superfamily protein (.1) AT2G29740 49 / 5e-08 UGT71C2 UDP-glucosyl transferase 71C2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039037 [exp] 141 / 2e-41 AT1G07250 378 / 8e-127 UDP-glucosyl transferase 71C4 (.1) Lus10010476 [exp] 66 / 5e-14 AT1G07250 342 / 7e-113 UDP-glucosyl transferase 71C4 (.1) Lus10003805 [exp] 63 / 4e-13 AT1G07250 332 / 5e-109 UDP-glucosyl transferase 71C4 (.1) Lus10026795 [exp] 62 / 1e-12 AT3G21750 448 / 5e-155 UDP-glucosyl transferase 71B1 (.1) Lus10036087 [exp] 57 / 5e-11 AT3G21790 455 / 3e-157 UDP-Glycosyltransferase superfamily protein (.1) Lus10039301 [exp] 50 / 2e-08 AT3G16520 481 / 9e-168 UDP-glucosyl transferase 88A1 (.1.2.3) Lus10027542 [exp] 47 / 3e-07 AT3G16520 431 / 3e-148 UDP-glucosyl transferase 88A1 (.1.2.3) Lus10036086 [exp] 44 / 3e-06 AT3G21760 431 / 2e-147 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1) Lus10036088 [exp] 44 / 4e-06 AT3G21760 377 / 3e-126 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G015700 [exp] 92 / 3e-23 AT3G21760 354 / 6e-118 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1) Potri.016G015800 [exp] 90 / 2e-22 AT1G07250 395 / 3e-134 UDP-glucosyl transferase 71C4 (.1) Potri.016G014500 [exp] 84 / 1e-20 AT1G07250 394 / 3e-133 UDP-glucosyl transferase 71C4 (.1) Potri.006G009900 [exp] 82 / 3e-20 AT1G07250 160 / 4e-46 UDP-glucosyl transferase 71C4 (.1) Potri.009G044600 [exp] 70 / 2e-15 AT2G29730 488 / 2e-170 UDP-glucosyl transferase 71D1 (.1) Potri.016G014350 [exp] 67 / 2e-14 AT3G21760 367 / 7e-123 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1) Potri.016G014401 [exp] 66 / 3e-14 AT3G21760 363 / 3e-121 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1) Potri.006G010000 [exp] 66 / 3e-14 AT1G07250 375 / 3e-126 UDP-glucosyl transferase 71C4 (.1) Potri.006G007600 [exp] 66 / 4e-14 AT3G21760 448 / 3e-154 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1) Potri.016G014100 [exp] 66 / 6e-14 AT3G21760 365 / 4e-122 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027335 pacid=23145391 polypeptide=Lus10027335 locus=Lus10027335.g ID=Lus10027335.BGIv1.0 annot-version=v1.0 ATGATCGACGTAGCCAACGAGCTCGGAATTCCTTCCTTCCTCTTCTTCACTTCCTCGATCGCGTTTCTAGGTTTCATGCTCTACCCCCCGATCCGCCACG ACCGAGTCGGAACTGGTTTCGAATTGGACGATCCAGCCGAGTCGGTACCGGTCCCGAGTTACGCCACCCCGATCCCTTCTCGCTTCCTGCCGTCCGTCCT CCTGGACAATCGCGGCGGCGGCTACTCCACGATGACAAACCACGGCAGGAGGTTTTGGGAAACCTAA
AA sequence Show only first row Show all	>Lus10027335 pacid=23145391 polypeptide=Lus10027335 locus=Lus10027335.g ID=Lus10027335.BGIv1.0 annot-version=v1.0 MIDVANELGIPSFLFFTSSIAFLGFMLYPPIRHDRVGTGFELDDPAESVPVPSYATPIPSRFLPSVLLDNRGGGYSTMTNHGRRFWET

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G07250		UGT71C4	UDP-glucosyl transferase 71C4 ...		Lus10027335 [exp]	0	1
AT4G20300			Protein of unknown function (D...		Lus10038379 [exp]	2.0	0.9015
AT3G60330		AHA7	H\(+\)-ATPase 7, H\(+\)-ATPase...		Lus10042904 [exp]	5.1	0.9026
AT5G06130			chaperone protein dnaJ-related...		Lus10022688 [exp]	5.1	0.8633
AT1G28540			unknown protein		Lus10025433 [exp]	6.0	0.8921
					Lus10039025 [exp]	8.1	0.8955
AT5G44120		ATCRA1, CRU1, C...	CRUCIFERINA, RmlC-like cupins ...		Lus10022929 [exp]	8.1	0.8907
					Lus10021668 [exp]	8.3	0.8562
AT2G45530			RING/U-box superfamily protein...		Lus10033252 [exp]	9.0	0.8761
AT2G37640		ATHEXPALPHA1.9,...	ARABIDOPSIS THALIANA EXPANSIN ...		Lus10002638 [exp]	12.7	0.8839
AT1G79900		ATMBAC2, BAC2	RABIDOPSIS MITOCHONDRIAL BASIC...		Lus10011451 [exp]	14.3	0.8164

Compare expression of checked genes

Lus10027335 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.