Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G65600 63 / 2e-12 Concanavalin A-like lectin protein kinase family protein (.1) AT5G10530 53 / 4e-09 Concanavalin A-like lectin protein kinase family protein (.1) AT5G60280 44 / 6e-06 Concanavalin A-like lectin protein kinase family protein (.1) AT3G53810 44 / 1e-05 Concanavalin A-like lectin protein kinase family protein (.1) AT4G02410 43 / 2e-05 Concanavalin A-like lectin protein kinase family protein (.1) AT2G37710 42 / 4e-05 RLK receptor lectin kinase (.1) AT4G02420 42 / 4e-05 Concanavalin A-like lectin protein kinase family protein (.1) AT4G29050 40 / 0.0001 Concanavalin A-like lectin protein kinase family protein (.1) AT4G04960 40 / 0.0002 Concanavalin A-like lectin protein kinase family protein (.1) AT4G28350 39 / 0.0004 Concanavalin A-like lectin protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004279 [exp] 125 / 3e-34 AT5G10530 578 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10016833 [exp] 74 / 3e-16 AT5G10530 575 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10016836 [exp] 74 / 4e-16 AT3G16810 761 / 0.0 pumilio 24 (.1) Lus10029554 [exp] 71 / 3e-15 AT5G10530 590 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10029553 [exp] 69 / 2e-14 AT5G10530 591 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10042309 [exp] 66 / 2e-13 AT5G10530 238 / 2e-72 Concanavalin A-like lectin protein kinase family protein (.1) Lus10020456 [exp] 62 / 5e-12 AT5G10530 519 / 1e-176 Concanavalin A-like lectin protein kinase family protein (.1) Lus10014648 [exp] 61 / 9e-12 AT5G10530 462 / 4e-154 Concanavalin A-like lectin protein kinase family protein (.1) Lus10033783 [exp] 60 / 3e-11 AT5G10530 468 / 2e-156 Concanavalin A-like lectin protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G004200 [exp] 102 / 2e-26 AT5G10530 570 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.007G004400 [exp] 84 / 8e-20 AT5G10530 738 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.007G004300 [exp] 80 / 2e-18 AT5G10530 743 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.007G004500 [exp] 79 / 4e-18 AT5G10530 725 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283700 [exp] 65 / 3e-13 AT5G10530 497 / 7e-168 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283208 [exp] 63 / 2e-12 AT5G10530 478 / 3e-160 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283866 [exp] 63 / 2e-12 AT5G10530 478 / 3e-160 Concanavalin A-like lectin protein kinase family protein (.1) Potri.003G094700 [exp] 61 / 7e-12 AT5G10530 764 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G284200 [exp] 61 / 1e-11 AT5G10530 441 / 8e-148 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283200 [exp] 61 / 1e-11 AT5G10530 382 / 8e-125 Concanavalin A-like lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [flax] [poplar] Concanavalin PF00139 [flax] [poplar] Lectin_legB Legume lectin domain
Representative CDS sequence Show only first row Show all	>Lus10027340 pacid=23145372 polypeptide=Lus10027340 locus=Lus10027340.g ID=Lus10027340.BGIv1.0 annot-version=v1.0 ATGAATAAAACGCCGTCGACGAGAGCCTCCGTAGTAGCATCGGATGCGTCACATCCCGCCAGCTCATCCCTCTATGGGACTCTAACAGGGGAAGTTACCA ATTTCACCACCCACTTCACCTTCACGATGAAAGCTGTCAAGCTGTCAACGGGAGAAACTTTCTTCCTATCGCCAGCGAATTTCCAGATTTCGGCGAACTC TACCGGCGGGTACCACACTCTGTTTACCCCGAAAACTTCCTTAAACTCCGATAAGAGCCATCAGATCGTGGCGGTTGAGTTCGACAACATCCGATATTCT TGGGATCCGAGCGACGATCACGTCGGGATCGACGTCAACTCAATCCGTTCCGGCGCAGTGCCGCATTGGGAAGAACGATTCAACCTTTAG
AA sequence Show only first row Show all	>Lus10027340 pacid=23145372 polypeptide=Lus10027340 locus=Lus10027340.g ID=Lus10027340.BGIv1.0 annot-version=v1.0 MNKTPSTRASVVASDASHPASSSLYGTLTGEVTNFTTHFTFTMKAVKLSTGETFFLSPANFQISANSTGGYHTLFTPKTSLNSDKSHQIVAVEFDNIRYS WDPSDDHVGIDVNSIRSGAVPHWEERFNL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G65600			Concanavalin A-like lectin pro...		Lus10027340 [exp]	0	1
AT4G09740		ATGH9B14	glycosyl hydrolase 9B14 (.1)		Lus10017525 [exp]	8.7	0.7471
AT5G02290		NAK	Protein kinase superfamily pro...		Lus10023794 [exp]	10.6	0.7593
AT1G30690			Sec14p-like phosphatidylinosit...		Lus10031176 [exp]	15.2	0.7577
AT1G49170			Protein of unknown function (D...		Lus10042819 [exp]	15.7	0.7509
AT3G28860		ABCB19, ATMDR11...	P-GLYCOPROTEIN 19, MULTIDRUG R...		Lus10032911 [exp]	17.0	0.7508
AT3G48040		ROP10, ARAC8, A...	Arabidopsis RAC-like 8, RHO-re...		Lus10033411 [exp]	18.7	0.7155
AT4G05400			copper ion binding (.1.2)		Lus10031070 [exp]	22.0	0.7108
AT5G16920			Fasciclin-like arabinogalactan...		Lus10013786 [exp]	22.3	0.7455
AT2G15220			Plant basic secretory protein ...		Lus10014106 [exp]	25.0	0.7049
AT1G53050			Protein kinase superfamily pro...		Lus10033684 [exp]	31.3	0.7404

Compare expression of checked genes

Lus10027340 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.