Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G050900 [exp] 53 / 2e-10 ND / Potri.012G127000 [exp] 52 / 2e-10 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027352 pacid=23145507 polypeptide=Lus10027352 locus=Lus10027352.g ID=Lus10027352.BGIv1.0 annot-version=v1.0 ATGGTTGCTCGTCGCAATGGGATCCATTTCCTTCATGGGATTTCTCTTTGCTGCCGCCATATCAAAGCTTCTTCCTCTATCCAGCAATTCAGGAAGACAG GTGGTTTATCTCGCACTATCTACTTTCATGAAGTTTTCCTAGCTCAGGAAGAAGAGAATGCTCAAAGACCGAATTTTGATCCTCATTTTCGTATCGGGCA CTACTGTTTGCCTGTGCCATTGACACTGCCGATCCTCTTCGTCGCTGTGTACTTCCACTGGCTTAGCACAAAGCTTTTCAAGCACGCTTGA
AA sequence Show only first row Show all	>Lus10027352 pacid=23145507 polypeptide=Lus10027352 locus=Lus10027352.g ID=Lus10027352.BGIv1.0 annot-version=v1.0 MVARRNGIHFLHGISLCCRHIKASSSIQQFRKTGGLSRTIYFHEVFLAQEEENAQRPNFDPHFRIGHYCLPVPLTLPILFVAVYFHWLSTKLFKHA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10027352 [exp]	0	1
AT5G08300			Succinyl-CoA ligase, alpha sub...		Lus10010186 [exp]	1.0	0.9236
AT1G68552		CPuORF53	conserved peptide upstream ope...		Lus10034317 [exp]	1.4	0.9039
AT2G47830			Cation efflux family protein (...		Lus10009817 [exp]	2.4	0.8374
AT5G08300			Succinyl-CoA ligase, alpha sub...		Lus10010185 [exp]	5.5	0.7901
AT4G19985			Acyl-CoA N-acyltransferases (N...		Lus10003688 [exp]	6.0	0.7543
AT1G68552		CPuORF53	conserved peptide upstream ope...		Lus10041455 [exp]	8.4	0.7685
AT1G05160		ATKAO1, CYP88A3	ENT-KAURENOIC ACID OXYDASE 1, ...		Lus10036670 [exp]	11.6	0.6919
AT5G02320	MYB	MYB3R-5, ATMYB3...	ARABIDOPSIS THALIANA MYB DOMAI...		Lus10008010 [exp]	12.2	0.8299
AT5G14490	NAC	ANAC085	NAC domain containing protein ...		Lus10003668 [exp]	14.9	0.7845
AT5G24280		GMI1	gamma-irradiation and mitomyci...		Lus10022400 [exp]	16.1	0.7125

Compare expression of checked genes

Lus10027352 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.