Lus10027365 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G08820 129 / 1e-35 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G02750 128 / 3e-35 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G09410 122 / 3e-33 pentatricopeptide (PPR) repeat-containing protein (.1)
AT3G24000 121 / 6e-33 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G44230 120 / 1e-32 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G49142 120 / 2e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G20230 120 / 2e-32 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G40410 119 / 5e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G03880 119 / 5e-32 REME1 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G18750 119 / 6e-32 DOT4 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002561 145 / 1e-46 AT3G24000 91 / 3e-23 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10013149 128 / 2e-35 AT1G56690 946 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10008967 125 / 5e-34 AT4G21300 876 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10028855 123 / 1e-33 AT4G21300 873 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10022890 123 / 1e-33 AT3G61170 865 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10039117 122 / 3e-33 AT3G24000 740 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10029436 122 / 4e-33 AT3G08820 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10000117 118 / 1e-32 AT4G21065 404 / 5e-139 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10040577 117 / 2e-32 AT1G25360 577 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G258500 179 / 2e-53 AT2G40720 481 / 4e-157 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G105700 131 / 2e-36 AT3G08820 810 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G027800 131 / 2e-36 AT1G25360 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.017G091600 129 / 2e-35 AT4G37170 924 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G119000 127 / 5e-35 AT5G44230 792 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.016G128900 127 / 6e-35 AT3G08820 812 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G059400 124 / 6e-34 AT4G18750 1110 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G021300 123 / 2e-33 AT1G20230 852 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.016G051300 122 / 2e-33 AT3G13770 908 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G014800 122 / 2e-33 AT5G40410 749 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10027365 pacid=23145437 polypeptide=Lus10027365 locus=Lus10027365.g ID=Lus10027365.BGIv1.0 annot-version=v1.0
ATGCCTGTAGAGCCTGATGCATCCATTTGGAGAGCTCTTCTGAATGGCTGCAGAGTGCATTCAGACCCGGAAATGGCTGCATCGGTGTTTCGGAACCTGG
TTTGGTTGGAACCGATGAATCCTGGGAACTATGTGTTGCTGGGGAACATCTATGCAGCAGCAGGGCTTTGGTCTGATGTTAGGCATGTGAGGACATTGTT
GAAGGAGAAGGGTTTGAAGAAGGCTCCGGGAATCAGTTGGATTGTGGTTGAAGGTGAAGTTCATTGTTTTGCTGCTGGTGATACATCGCATCCGGATTCT
GTTGAGGTTTATGCAAGTTTGGAATCTTTGTTGGATCTGATGAGAGAAGTTGGATATGATAGTGAATGTAATAGTTTCATATTACATGATGAAGAGGATT
AG
AA sequence
>Lus10027365 pacid=23145437 polypeptide=Lus10027365 locus=Lus10027365.g ID=Lus10027365.BGIv1.0 annot-version=v1.0
MPVEPDASIWRALLNGCRVHSDPEMAASVFRNLVWLEPMNPGNYVLLGNIYAAAGLWSDVRHVRTLLKEKGLKKAPGISWIVVEGEVHCFAAGDTSHPDS
VEVYASLESLLDLMREVGYDSECNSFILHDEED

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G02750 Tetratricopeptide repeat (TPR)... Lus10027365 0 1
AT4G02750 Tetratricopeptide repeat (TPR)... Lus10003857 2.2 0.8371
AT5G04780 Pentatricopeptide repeat (PPR)... Lus10021649 2.4 0.8521
AT1G13410 Tetratricopeptide repeat (TPR)... Lus10021069 2.6 0.8548
Lus10029579 3.0 0.8505
AT3G29230 Tetratricopeptide repeat (TPR)... Lus10027455 3.5 0.8271
AT4G02340 alpha/beta-Hydrolases superfam... Lus10039814 4.0 0.8115
AT5G04780 Pentatricopeptide repeat (PPR)... Lus10034715 5.3 0.8395
AT3G49710 Pentatricopeptide repeat (PPR)... Lus10006743 5.7 0.7967
AT3G46790 CRR2 CHLORORESPIRATORY REDUCTION 2,... Lus10001558 6.2 0.8029
AT3G55120 A11, CFI, TT5 TRANSPARENT TESTA 5, CHALCONE ... Lus10030309 6.3 0.8090

Lus10027365 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.