Lus10027384 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17350 37 / 0.0004 NADH:ubiquinone oxidoreductase intermediate-associated protein 30 (.1.2)
AT1G72420 36 / 0.0006 NADH:ubiquinone oxidoreductase intermediate-associated protein 30 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003912 48 / 4e-08 AT4G14180 68 / 8e-13 putative recombination initiation defect 1 (.1)
Lus10035323 47 / 4e-08 AT1G17350 235 / 2e-79 NADH:ubiquinone oxidoreductase intermediate-associated protein 30 (.1.2)
Lus10029985 47 / 4e-08 AT1G17350 336 / 1e-118 NADH:ubiquinone oxidoreductase intermediate-associated protein 30 (.1.2)
Lus10001051 46 / 2e-07 AT1G06660 283 / 6e-90 JASON, unknown protein
Lus10001417 40 / 2e-05 AT1G06660 228 / 3e-69 JASON, unknown protein
Lus10020732 36 / 0.0007 AT1G06660 310 / 1e-100 JASON, unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G076600 45 / 2e-07 AT1G17350 318 / 4e-111 NADH:ubiquinone oxidoreductase intermediate-associated protein 30 (.1.2)
PFAM info
Representative CDS sequence
>Lus10027384 pacid=23145481 polypeptide=Lus10027384 locus=Lus10027384.g ID=Lus10027384.BGIv1.0 annot-version=v1.0
ATGCCCCCTTCTGAGAGACTTATTTTCGGCTTCAACTCCAAAGAAGAGATAAAGAAATGGCATCTGTATTCAGATTCTGAGTATGGAGAGGAAGAAGATT
ATCCAGCTACTTATGATAACAAGGGAAATCTATCTTGGCTGTCTCCCCGGACTTGGAAAGAGCTTAGGGATGAGGTATGCATCTACTGA
AA sequence
>Lus10027384 pacid=23145481 polypeptide=Lus10027384 locus=Lus10027384.g ID=Lus10027384.BGIv1.0 annot-version=v1.0
MPPSERLIFGFNSKEEIKKWHLYSDSEYGEEEDYPATYDNKGNLSWLSPRTWKELRDEVCIY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17350 NADH:ubiquinone oxidoreductase... Lus10027384 0 1
AT1G19100 Histidine kinase-, DNA gyrase ... Lus10039959 1.0 0.9364
Lus10041093 1.7 0.9120
AT2G24960 unknown protein Lus10026250 2.8 0.8956
AT4G31150 endonuclease V family protein ... Lus10024534 3.5 0.8960
Lus10014678 4.5 0.9191
AT5G40600 EMB1875 unknown protein Lus10003647 4.6 0.8958
AT5G40410 Tetratricopeptide repeat (TPR)... Lus10021229 4.9 0.8824
AT5G07910 Leucine-rich repeat (LRR) fami... Lus10021635 8.6 0.8553
AT5G67170 SEC-C motif-containing protein... Lus10006255 9.9 0.8887
AT1G43620 UGT80B1, TT15 TRANSPARENT TESTA 15, UDP-Glyc... Lus10005004 10.2 0.8646

Lus10027384 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.