Lus10027385 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034344 43 / 4e-06 AT1G68370 624 / 0.0 ALTERED RESPONSE TO GRAVITY 1, Chaperone DnaJ-domain superfamily protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10027385 pacid=23145452 polypeptide=Lus10027385 locus=Lus10027385.g ID=Lus10027385.BGIv1.0 annot-version=v1.0
ATGGTTGCTTGTTCGGAAGAAGAAGAAGAAGAAGAAGAGAAACAGAAGTTTAGCAGAGAGAGAGTTGGCCGGCGGCGGAGCGGGTGGTTCTGGAGTTCCA
ACCAAGCACTGATACCATGTCAAATTATGAGGGAAAGAGTAGGTAAGCTTGTTCCTATAAAGATAGGAATTGGTAGGCGTTGGCGACGGCAGGGAGGAGT
GAGGATCGCCGGCGGAATCGACGCGGAGTGGACTCAGTAG
AA sequence
>Lus10027385 pacid=23145452 polypeptide=Lus10027385 locus=Lus10027385.g ID=Lus10027385.BGIv1.0 annot-version=v1.0
MVACSEEEEEEEEKQKFSRERVGRRRSGWFWSSNQALIPCQIMRERVGKLVPIKIGIGRRWRRQGGVRIAGGIDAEWTQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10027385 0 1
AT3G19700 IKU2 HAIKU2, Leucine-rich repeat pr... Lus10012461 6.3 0.7702
AT4G15780 ATVAMP724 vesicle-associated membrane pr... Lus10037511 14.7 0.6616
AT2G26790 Pentatricopeptide repeat (PPR)... Lus10020299 20.3 0.7971
AT5G60410 ATSIZ1, SIZ1 DNA-binding protein with MIZ/S... Lus10038464 32.7 0.7443
AT3G14470 NB-ARC domain-containing disea... Lus10022351 32.9 0.7448
AT5G16630 ATRAD4 DNA repair protein Rad4 family... Lus10000108 33.1 0.7757
AT4G00730 HD AHDP, ANL2 ANTHOCYANINLESS 2, ARABIDOPSIS... Lus10003299 37.1 0.7306
AT1G80550 Pentatricopeptide repeat (PPR)... Lus10037555 44.3 0.7072
AT1G66950 ABCG39, PDR11, ... ATP-binding cassette G39, plei... Lus10028841 53.8 0.7453
Lus10031222 57.9 0.6915

Lus10027385 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.