Lus10027391 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G28100 43 / 5e-06 ATFUC1 alpha-L-fucosidase 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027390 175 / 4e-54 AT2G28100 476 / 6e-165 alpha-L-fucosidase 1 (.1)
Lus10031681 158 / 9e-48 AT2G28100 485 / 2e-168 alpha-L-fucosidase 1 (.1)
Lus10021427 55 / 5e-10 AT2G28100 671 / 0.0 alpha-L-fucosidase 1 (.1)
Lus10016140 54 / 1e-09 AT2G28100 644 / 0.0 alpha-L-fucosidase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G133500 130 / 2e-37 AT2G28100 502 / 3e-175 alpha-L-fucosidase 1 (.1)
Potri.012G131400 121 / 5e-34 AT2G28100 506 / 6e-177 alpha-L-fucosidase 1 (.1)
Potri.009G006900 44 / 2e-06 AT2G28100 704 / 0.0 alpha-L-fucosidase 1 (.1)
PFAM info
Representative CDS sequence
>Lus10027391 pacid=23144599 polypeptide=Lus10027391 locus=Lus10027391.g ID=Lus10027391.BGIv1.0 annot-version=v1.0
ATGGAGTATTGGATTGAGATAAAGTGTGGTGGTGATGGGTTGAAGAAATTCAATGTGATTAGGGTTCAAGAGGCGAATGGGTTAGGGCAAAGGGTTAAAC
GACATGAGGTTTATGTGGATGGTGTTAGAGTTGCTCAAGGGACACCTGTTGGGTACAAGAGGCTACATAGGCTCGAGAAGGGAGTGGTGCTTAGTGGGGA
GAGTGTGAGGGTTAAAGTGTTGGAATCTAGAGTCGTACCTTTGATTTCTTCGATTGGGATCCACTATGACCTTTATTGGCATCTTTAA
AA sequence
>Lus10027391 pacid=23144599 polypeptide=Lus10027391 locus=Lus10027391.g ID=Lus10027391.BGIv1.0 annot-version=v1.0
MEYWIEIKCGGDGLKKFNVIRVQEANGLGQRVKRHEVYVDGVRVAQGTPVGYKRLHRLEKGVVLSGESVRVKVLESRVVPLISSIGIHYDLYWHL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10027391 0 1
AT1G30520 AAE14 acyl-activating enzyme 14 (.1) Lus10009704 1.7 0.8272
AT5G02250 ATMTRNASEII, RN... ribonucleotide reductase 1, EM... Lus10010842 2.6 0.8556
AT3G59570 Ypt/Rab-GAP domain of gyp1p su... Lus10022963 10.4 0.7733
AT5G09300 Thiamin diphosphate-binding fo... Lus10033480 12.2 0.6918
AT5G14930 GENE101, SAG101 senescence-associated gene 101... Lus10004841 12.6 0.8339
AT4G34180 Cyclase family protein (.1) Lus10031454 12.7 0.7850
AT5G50670 SBP SPL13B SQUAMOSA PROMOTER-BINDING PROT... Lus10015764 13.2 0.8191
AT1G06510 unknown protein Lus10031459 15.0 0.7836
AT1G01320 Tetratricopeptide repeat (TPR)... Lus10020453 16.0 0.7567
AT2G20020 CAF1, ATCAF1 RNA-binding CRS1 / YhbY (CRM) ... Lus10034952 16.2 0.8049

Lus10027391 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.