Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020729 [exp] 63 / 7e-13 AT5G17230 491 / 7e-174 PHYTOENE SYNTHASE (.1.2.3) Lus10020891 [exp] 57 / 4e-12 ND / Lus10005051 [exp] 50 / 1e-08 AT3G51780 221 / 1e-69 BCL-2-associated athanogene 4 (.1) Lus10012249 [exp] 44 / 5e-06 AT1G20720 1074 / 0.0 RAD3-like DNA-binding helicase protein (.1) Lus10001468 [exp] 42 / 3e-05 AT4G02280 1385 / 0.0 sucrose synthase 3 (.1) Lus10006033 [exp] 40 / 5e-05 AT4G32830 488 / 2e-175 ataurora1 (.1) Lus10033508 [exp] 39 / 0.0001 AT1G24090 283 / 3e-93 RNase H family protein (.1) Lus10020869 [exp] 39 / 0.0002 AT1G24090 297 / 8e-99 RNase H family protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027418 pacid=23144515 polypeptide=Lus10027418 locus=Lus10027418.g ID=Lus10027418.BGIv1.0 annot-version=v1.0 ATGGCAGGCCTTCAGATAGCTTGGGAGAGAGGGTACCAGAAAGTACAGGTACAGTTCGATTCCTGCTGCGCATTGCAGTTGATACGTCAGCTGTCAGGGG GGATTCACCAACACTCTGTTGTTGTAAGTCAGATTCAAGAGTTGATGAGGACGGCGTGGGAGCTCGAGTTTGTTCATATCTTTCGTGAAGGCAATCATAA TGTTGATTACCTTGCCAACATTGAGCACGAGATGCCTTTTGGTGTTTATTCTTTTCCTATTTCATATCCTATTTTCACCTATTGA
AA sequence Show only first row Show all	>Lus10027418 pacid=23144515 polypeptide=Lus10027418 locus=Lus10027418.g ID=Lus10027418.BGIv1.0 annot-version=v1.0 MAGLQIAWERGYQKVQVQFDSCCALQLIRQLSGGIHQHSVVVSQIQELMRTAWELEFVHIFREGNHNVDYLANIEHEMPFGVYSFPISYPIFTY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10027418 [exp]	0	1
AT2G15780			Cupredoxin superfamily protein...		Lus10025269 [exp]	2.0	0.8258
AT3G07970		QRT2	QUARTET 2, Pectin lyase-like s...		Lus10029511 [exp]	6.3	0.7343
AT5G05340			Peroxidase superfamily protein...		Lus10032786 [exp]	9.3	0.7911
AT3G17220		ATPMEI2	pectin methylesterase inhibito...		Lus10017345 [exp]	11.2	0.7892
					Lus10021407 [exp]	13.0	0.7884
AT3G49780		ATPSK3(FORMERSY...	phytosulfokine 4 precursor (.1...		Lus10011721 [exp]	13.6	0.7846
AT1G69630			F-box/RNI-like superfamily pro...		Lus10011410 [exp]	15.5	0.7842
					Lus10025782 [exp]	17.3	0.7778
AT2G47190	MYB	AtMYB2	myb domain protein 2 (.1)		Lus10009996 [exp]	21.4	0.7734
AT2G47190	MYB	AtMYB2	myb domain protein 2 (.1)		Lus10038062 [exp]	22.4	0.7700

Compare expression of checked genes

Lus10027418 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.