Plant FIBer expression Database

Lus10027419 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G52800 89 / 7e-22 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G15540 75 / 6e-17 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G52790 73 / 3e-16 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G80320 72 / 6e-16 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G03070 70 / 4e-15 AOP1.1, AOP1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G52820 63 / 1e-12 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G52810 56 / 6e-10 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G28030 50 / 6e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G03050 49 / 1e-07 AOP3 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G14130 39 / 0.0003 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005776
[exp]
232 / 2e-77 AT1G52790 198 / 2e-61 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005774
[exp]
225 / 1e-75 AT1G52790 144 / 2e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005773
[exp]
226 / 4e-75 AT1G52790 205 / 3e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005775
[exp]
167 / 3e-55 AT1G52800 70 / 1e-15 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021025
[exp]
147 / 3e-44 AT1G52800 226 / 2e-72 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10023024
[exp]
62 / 5e-12 AT1G52820 371 / 2e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10013130
[exp]
59 / 6e-11 AT1G52820 200 / 3e-62 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10016659
[exp]
58 / 8e-11 AT1G52820 445 / 1e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10013132
[exp]
57 / 2e-10 AT1G52800 222 / 8e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G176500
[exp]
94 / 7e-24 AT1G52800 338 / 1e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176000
[exp]
88 / 1e-21 AT1G52790 460 / 2e-164 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.006G248000
[exp]
74 / 2e-16 AT1G52820 280 / 6e-93 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176200
[exp]
74 / 3e-16 AT1G52820 496 / 8e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.018G033400
[exp]
72 / 6e-16 AT1G52820 269 / 4e-89 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176100
[exp]
71 / 3e-15 AT1G52800 286 / 5e-96 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G175900
[exp]
54 / 4e-09 AT1G52820 328 / 2e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G175800
[exp]
51 / 2e-08 AT1G52820 338 / 2e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10027419 pacid=23144551 polypeptide=Lus10027419 locus=Lus10027419.g ID=Lus10027419.BGIv1.0 annot-version=v1.0
ATGGAAGAGTTCGGGTGTTTCCAGGCCATATACACCGGGGCCAGCGAGATTCCGATTTTCAAGACAATAGAAGAGCTGTTCGATCTTCCTGATGAGATAA
AAAACAAGAACACCAGCACGAAGCCCTTCTTCGGGGGTTCCGTGCGGAGTCCTCTCAACAGTCATACTCACGAATCACTAGGGATAGATAACCCGACAAG
CATCGATACCACTCGAGGCTTCGCGTACCTTATGTGGCCGGATTCTGGAAATGATGCATTATGCCAGGCGAGTCTTTCCATGTCGAAGCTAATGACGGAA
CTATTGGAGACCATTTTCAAGATGATGGTGGAAAGCTATGAGATTGTCGAATTAGGGTTTGGATCTGAGTCGATGAATAACCAAATTCGGTTCTTTTAA
AA sequence
>Lus10027419 pacid=23144551 polypeptide=Lus10027419 locus=Lus10027419.g ID=Lus10027419.BGIv1.0 annot-version=v1.0
MEEFGCFQAIYTGASEIPIFKTIEELFDLPDEIKNKNTSTKPFFGGSVRSPLNSHTHESLGIDNPTSIDTTRGFAYLMWPDSGNDALCQASLSMSKLMTE
LLETIFKMMVESYEIVELGFGSESMNNQIRFF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Download tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G52800 2-oxoglutarate (2OG) and Fe(II... Lus10027419
[exp]
0 1

Lus10027419 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.