Lus10027443 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005752 197 / 4e-66 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G140800 78 / 5e-19 ND /
PFAM info
Representative CDS sequence
>Lus10027443 pacid=23144444 polypeptide=Lus10027443 locus=Lus10027443.g ID=Lus10027443.BGIv1.0 annot-version=v1.0
ATGGACGACTCCGGTAGCAGCACCACCAACCACAACCACAACAACAACAACAACAACCGTATATGGACTAACGAGAAGCACCTGAATTTCTTGAACTCGC
TGGAGGCCACCTTCGTCCGCACAATGCTAATCGAAAACAACAATAATTACTCGTCGACTCGCCACCCCCGCCACAGCTACGAGCACGATCTCCGACTCGA
TCGGTACTTGCCGGATAGTTTGGAGTCGACTCTTGACTCCACAACAGACAGGCCTAAAAAGTCTGCCACCGCCTCAGCTGACCATAGGAGATCAAGGAGA
TTATCACTTTCATCATCTGGGAGCACTACTCGATCTCAAATGACTCAGAATTCAAATTCGTCGCATGATCAGGTTGTCCCACAGCTCAGCATCAGAAGCA
ATGATAAACAAACAGCTGCTGCTGATTGA
AA sequence
>Lus10027443 pacid=23144444 polypeptide=Lus10027443 locus=Lus10027443.g ID=Lus10027443.BGIv1.0 annot-version=v1.0
MDDSGSSTTNHNHNNNNNNRIWTNEKHLNFLNSLEATFVRTMLIENNNNYSSTRHPRHSYEHDLRLDRYLPDSLESTLDSTTDRPKKSATASADHRRSRR
LSLSSSGSTTRSQMTQNSNSSHDQVVPQLSIRSNDKQTAAAD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10027443 0 1
Lus10005752 1.0 0.9118
AT3G20810 JMJ30, JMJD5 2-oxoglutarate (2OG) and Fe(II... Lus10031247 4.2 0.8343
AT1G61680 ATTPS14 terpene synthase 14 (.1.2) Lus10035240 4.2 0.7512
AT5G61380 AtTOC1, TOC1, A... PSEUDO-RESPONSE REGULATOR 1, T... Lus10015720 5.5 0.8321
Lus10014061 6.9 0.8025
AT5G48250 CO COL10 B-box type zinc finger protein... Lus10036419 6.9 0.8141
AT2G36190 ATCWINV4 cell wall invertase 4 (.1) Lus10014219 7.7 0.7493
AT2G14080 Disease resistance protein (TI... Lus10023330 8.8 0.7712
AT5G07580 AP2_ERF Integrase-type DNA-binding sup... Lus10032498 8.8 0.7692
AT4G02340 alpha/beta-Hydrolases superfam... Lus10037559 9.5 0.7893

Lus10027443 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.