Lus10027444 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G52200 96 / 8e-25 AtI-2 inhibitor-2, phosphoprotein phosphatase inhibitors (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005751 238 / 3e-80 AT5G52200 127 / 3e-37 inhibitor-2, phosphoprotein phosphatase inhibitors (.1.2)
Lus10014992 140 / 6e-42 AT5G52200 122 / 5e-35 inhibitor-2, phosphoprotein phosphatase inhibitors (.1.2)
Lus10038872 136 / 5e-40 AT5G52200 118 / 3e-33 inhibitor-2, phosphoprotein phosphatase inhibitors (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G140500 169 / 2e-53 AT5G52200 123 / 9e-36 inhibitor-2, phosphoprotein phosphatase inhibitors (.1.2)
Potri.012G138600 137 / 3e-41 AT5G52200 137 / 2e-41 inhibitor-2, phosphoprotein phosphatase inhibitors (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04979 IPP-2 Protein phosphatase inhibitor 2 (IPP-2)
Representative CDS sequence
>Lus10027444 pacid=23144478 polypeptide=Lus10027444 locus=Lus10027444.g ID=Lus10027444.BGIv1.0 annot-version=v1.0
ATGGTGAATAAAGAACTCCCCGACGTGCTATTTGGCTCAGAAATGAAGGGACGAAGGTCGCGTGTAAGATGGGATGAAGATAATTTGGGGGAGATTGAAG
CTAATAAGCCGGTGAGACAAAAGATTACTGAACCTAAGACACCATACCACCCAATGCTTGATGACGACGATGATGATGTTGATGGTACATTATCTCCTAC
TAAGGTTAGCTTTGATGAGCCTGTTAATGACGCAACACATGCTGAAAAACTGCGAACTGCCTTAGACACTGTGGCTTCTTCATCAAGTGGGAACTCCAGC
AAGCGACCCACTGGCTGGACATCATCCGATGATGAAGCTGACCCTATGGACCAAGATGATGAAGATTGTGAAACGGACAGGGAAGCTTATTTTAGGGAGC
TCAGACGAGCACATTATGACGAGTTTTGGAAAGTAAAAGAACTCCTACGCAAGGGTTCTCTCGTCGAGGATGAAGATGCGGAGGCAAACGGCAATGGCAA
CGGCAAGCTAAAGAACGGTGGAGGAAGTTCATCTTCGTTAACTGCTGGCGTGAGGGACATCGACATTGAAGATGGTACTGCAACTTCGTCGAACCAACCT
GCACCGCCGCCACCACCCCCAGCTAACGGGTCTTAG
AA sequence
>Lus10027444 pacid=23144478 polypeptide=Lus10027444 locus=Lus10027444.g ID=Lus10027444.BGIv1.0 annot-version=v1.0
MVNKELPDVLFGSEMKGRRSRVRWDEDNLGEIEANKPVRQKITEPKTPYHPMLDDDDDDVDGTLSPTKVSFDEPVNDATHAEKLRTALDTVASSSSGNSS
KRPTGWTSSDDEADPMDQDDEDCETDREAYFRELRRAHYDEFWKVKELLRKGSLVEDEDAEANGNGNGKLKNGGGSSSSLTAGVRDIDIEDGTATSSNQP
APPPPPPANGS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G52200 AtI-2 inhibitor-2, phosphoprotein ph... Lus10027444 0 1
Lus10024538 3.6 0.8282
AT5G55160 ATSUMO2, SUMO2,... small ubiquitin-like modifier ... Lus10032560 9.0 0.7987
AT5G19490 CCAAT Histone superfamily protein (.... Lus10026780 11.8 0.8088
Lus10033601 16.3 0.8151
AT5G04280 AtRZ-1c AtRZ-1c, RNA-binding (RRM/RBD/... Lus10037950 20.2 0.7713
AT1G26480 GF14IOTA, GRF12 general regulatory factor 12 (... Lus10037089 20.2 0.8101
AT1G15340 MBD10 methyl-CPG-binding domain 10 (... Lus10019406 23.2 0.8270
Lus10022880 23.3 0.7787
AT3G58480 calmodulin-binding family prot... Lus10029323 24.7 0.7496
AT3G13200 EMB2769 EMBRYO DEFECTIVE 2769, Cwf15 /... Lus10022566 25.6 0.8133

Lus10027444 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.