Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G24320 199 / 3e-63 Ubiquitin carboxyl-terminal hydrolase family protein (.1) AT1G71850 155 / 2e-45 Ubiquitin carboxyl-terminal hydrolase family protein (.1) AT5G48040 130 / 2e-36 Ubiquitin carboxyl-terminal hydrolase family protein (.1) AT3G58520 116 / 4e-31 Ubiquitin carboxyl-terminal hydrolase family protein (.1.2) AT2G39120 109 / 1e-28 WTF9 what's this factor 9, Ubiquitin carboxyl-terminal hydrolase family protein (.1) AT3G63090 87 / 2e-20 Ubiquitin carboxyl-terminal hydrolase family protein (.1) AT5G45790 86 / 3e-20 Ubiquitin carboxyl-terminal hydrolase family protein (.1.2) AT1G06440 83 / 5e-19 Ubiquitin carboxyl-terminal hydrolase family protein (.1) AT4G33495 75 / 4e-16 RPD1 ROOT PRIMORDIUM DEFECTIVE 1, Ubiquitin carboxyl-terminal hydrolase family protein (.1) AT2G31290 74 / 7e-16 Ubiquitin carboxyl-terminal hydrolase family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005750 [exp] 185 / 8e-58 AT1G71850 263 / 9e-85 Ubiquitin carboxyl-terminal hydrolase family protein (.1) Lus10017896 [exp] 152 / 4e-43 AT1G71850 478 / 7e-164 Ubiquitin carboxyl-terminal hydrolase family protein (.1) Lus10035074 [exp] 150 / 2e-42 AT1G71850 479 / 5e-164 Ubiquitin carboxyl-terminal hydrolase family protein (.1) Lus10012201 [exp] 126 / 4e-35 AT5G48040 424 / 1e-147 Ubiquitin carboxyl-terminal hydrolase family protein (.1) Lus10011327 [exp] 126 / 5e-35 AT5G48040 425 / 1e-147 Ubiquitin carboxyl-terminal hydrolase family protein (.1) Lus10037979 [exp] 113 / 5e-31 AT2G39120 308 / 1e-104 what's this factor 9, Ubiquitin carboxyl-terminal hydrolase family protein (.1) Lus10000847 [exp] 112 / 5e-30 AT3G58520 501 / 1e-178 Ubiquitin carboxyl-terminal hydrolase family protein (.1.2) Lus10038710 [exp] 112 / 1e-29 AT2G39120 467 / 4e-164 what's this factor 9, Ubiquitin carboxyl-terminal hydrolase family protein (.1) Lus10015979 [exp] 112 / 1e-29 AT3G58520 564 / 0.0 Ubiquitin carboxyl-terminal hydrolase family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G223200 [exp] 227 / 1e-73 AT4G24320 437 / 4e-152 Ubiquitin carboxyl-terminal hydrolase family protein (.1) Potri.013G115500 [exp] 160 / 3e-46 AT1G71850 474 / 1e-161 Ubiquitin carboxyl-terminal hydrolase family protein (.1) Potri.002G230900 [exp] 128 / 1e-35 AT5G48040 484 / 9e-171 Ubiquitin carboxyl-terminal hydrolase family protein (.1) Potri.006G195900 [exp] 115 / 8e-31 AT3G58520 578 / 0.0 Ubiquitin carboxyl-terminal hydrolase family protein (.1.2) Potri.008G036600 [exp] 108 / 3e-28 AT2G39120 509 / 0.0 what's this factor 9, Ubiquitin carboxyl-terminal hydrolase family protein (.1) Potri.002G220000 [exp] 85 / 1e-19 AT3G63090 499 / 7e-177 Ubiquitin carboxyl-terminal hydrolase family protein (.1) Potri.016G030300 [exp] 85 / 2e-19 AT5G45790 466 / 8e-163 Ubiquitin carboxyl-terminal hydrolase family protein (.1.2) Potri.002G245100 [exp] 82 / 1e-18 AT1G06440 544 / 0.0 Ubiquitin carboxyl-terminal hydrolase family protein (.1) Potri.015G141700 [exp] 71 / 1e-14 AT4G33495 607 / 0.0 ROOT PRIMORDIUM DEFECTIVE 1, Ubiquitin carboxyl-terminal hydrolase family protein (.1) Potri.014G096800 [exp] 70 / 2e-14 AT4G01037 588 / 0.0 what's this factor?, Ubiquitin carboxyl-terminal hydrolase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11955 [flax] [poplar] PORR Plant organelle RNA recognition domain
Representative CDS sequence Show only first row Show all	>Lus10027445 pacid=23144439 polypeptide=Lus10027445 locus=Lus10027445.g ID=Lus10027445.BGIv1.0 annot-version=v1.0 ATGGCGTTAGGGGATCTGAGCAATGTCAAGAAAGGAGCTCGGATCGGGTTCTTGTTAAGCTACCCGAAAGGGTTCGATTTGGTGGACAAAGTCAAGGATT GGGTGTTTGAATGGCAGCATTTTCCGTACGTTTCGCCATACGAGAATGCTCTCCACTTGGATCCTGATGGCGATCAAGCTGAGAAGTGGACTGTGGCGGT TTTACACGAGCTGATGTGGCTGTTGGTGTCGAAGAAGACCGAGAGCGAGAATGTGCTTCGATTGGGGGAGTGTTTGGGGTTGCAAAGGAGGTTTAAGCGA GCTTTGGTTCAACATCCAGGGATATTCTATCTTTCGCACAAGGTTAGGACGCAGACTGTCGTGCTTCGGGAGGCGTTTTCGAAGAATCTGTTGAAGGTGA AGCACCCTTTGATGGGGATGAGGTTTAGGTACATTCATCTTATGAATATAGATAAGGAGAGGAGGAGACGAAGGAAGTTGGAGCGGGAGAGAAGTTCGAG GATGAGTAATCTGGTGGCTTGTGAAAGATAA
AA sequence Show only first row Show all	>Lus10027445 pacid=23144439 polypeptide=Lus10027445 locus=Lus10027445.g ID=Lus10027445.BGIv1.0 annot-version=v1.0 MALGDLSNVKKGARIGFLLSYPKGFDLVDKVKDWVFEWQHFPYVSPYENALHLDPDGDQAEKWTVAVLHELMWLLVSKKTESENVLRLGECLGLQRRFKR ALVQHPGIFYLSHKVRTQTVVLREAFSKNLLKVKHPLMGMRFRYIHLMNIDKERRRRRKLERERSSRMSNLVACER

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G24320			Ubiquitin carboxyl-terminal hy...		Lus10027445 [exp]	0	1
AT5G20990		B73, CNX1, SIR4...	SIRTINOL 4, CO-FACTOR FOR NITR...		Lus10001152 [exp]	5.3	0.6743
AT1G13290	C2H2ZnF	WIP6, DOT5	WIP domain protein 6, DEFECTIV...		Lus10035044 [exp]	5.7	0.6902
AT5G05800			unknown protein		Lus10007443 [exp]	10.5	0.6741
AT1G51405			myosin-related (.1)		Lus10009954 [exp]	11.4	0.7010
AT4G02750			Tetratricopeptide repeat (TPR)...		Lus10017298 [exp]	21.0	0.6227
AT2G36230		HISN3, APG10	ALBINO AND PALE GREEN 10, Aldo...		Lus10017042 [exp]	21.6	0.6911
AT1G18440			Peptidyl-tRNA hydrolase family...		Lus10042977 [exp]	27.7	0.6513
AT5G66530			Galactose mutarotase-like supe...		Lus10041758 [exp]	27.7	0.6563
AT5G61510			GroES-like zinc-binding alcoho...		Lus10009018 [exp]	28.6	0.6412
AT1G69630			F-box/RNI-like superfamily pro...		Lus10024695 [exp]	34.6	0.6717

Compare expression of checked genes

Lus10027445 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.