Lus10027460 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G23750 155 / 8e-48 Remorin family protein (.1.2)
AT3G61260 148 / 5e-45 Remorin family protein (.1)
AT3G48940 139 / 5e-42 Remorin family protein (.1)
AT2G45820 129 / 7e-38 Remorin family protein (.1)
AT1G63295 78 / 2e-18 Remorin family protein (.1)
AT1G67590 56 / 4e-09 Remorin family protein (.1.2)
AT1G30320 55 / 8e-09 Remorin family protein (.1)
AT2G41870 54 / 1e-08 Remorin family protein (.1)
AT3G57540 52 / 4e-08 Remorin family protein (.1)
AT1G53860 47 / 3e-06 Remorin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039215 278 / 4e-96 AT3G61260 196 / 7e-64 Remorin family protein (.1)
Lus10018840 142 / 9e-43 AT3G61260 206 / 1e-67 Remorin family protein (.1)
Lus10017811 134 / 1e-39 AT3G61260 199 / 5e-65 Remorin family protein (.1)
Lus10014785 129 / 1e-37 AT3G61260 177 / 1e-56 Remorin family protein (.1)
Lus10001477 125 / 7e-36 AT5G23750 162 / 3e-50 Remorin family protein (.1.2)
Lus10008477 122 / 3e-34 AT5G23750 154 / 5e-47 Remorin family protein (.1.2)
Lus10030379 114 / 4e-32 AT3G61260 178 / 4e-57 Remorin family protein (.1)
Lus10008014 112 / 7e-32 AT5G23750 158 / 5e-50 Remorin family protein (.1.2)
Lus10024514 90 / 7e-23 AT5G23750 113 / 5e-32 Remorin family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G081300 165 / 7e-52 AT3G61260 199 / 4e-65 Remorin family protein (.1)
Potri.002G157700 155 / 6e-48 AT3G61260 167 / 2e-52 Remorin family protein (.1)
Potri.015G143600 150 / 7e-46 AT5G23750 111 / 1e-30 Remorin family protein (.1.2)
Potri.003G124400 135 / 3e-40 AT5G23750 129 / 6e-38 Remorin family protein (.1.2)
Potri.012G140800 134 / 2e-39 AT5G23750 98 / 2e-25 Remorin family protein (.1.2)
Potri.001G107000 109 / 5e-30 AT5G23750 55 / 2e-09 Remorin family protein (.1.2)
Potri.008G178300 60 / 1e-10 AT1G67590 306 / 1e-102 Remorin family protein (.1.2)
Potri.008G144300 57 / 2e-09 AT2G02170 431 / 5e-147 Remorin family protein (.1.2)
Potri.006G053200 55 / 3e-09 AT3G57540 196 / 2e-61 Remorin family protein (.1)
Potri.016G054400 55 / 5e-09 AT2G41870 206 / 7e-66 Remorin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03763 Remorin_C Remorin, C-terminal region
Representative CDS sequence
>Lus10027460 pacid=23144593 polypeptide=Lus10027460 locus=Lus10027460.g ID=Lus10027460.BGIv1.0 annot-version=v1.0
ATGGCAGAGGAAGAAGCTAAGAAGCTCGTCCCTGAATCCCCTGCCTCCGCCGTCGTCGAACCTCCAAAGGATGTAGCTGAGGAAAAATCCGTAATTCCAA
CCCCTCCTTCTGAAGACAAGTCTGATCCTAAACCTGATGATGATTCCTCCAAGGCCATCGTCCCCCTCCAAAAGGAAGCAGAGCCAGTTTCAGAGGAGGC
AAAACCTGTTGAGGGATCTGTCAATCGAGATTTGGAGCTGGCCAGAGTAGAAACAGAGAAGAGGTTGTCTTTCATCAAAGCTTGGGAAGAGAGTGAGAAG
AGCAAAGCTGAGAACAAGGCTCACAAGAAGGTATCTGCAATTGAGTCATGGGAGAACAGCAAGAAAGCAGCTGTCGAGGCACAGCTCAGACAGTTTGAGG
AAAAACTGGAGAAGCAGAAGGCAGAGTACGCAGAGAAGATGAAGAACAAGATCGCCGAAATCCACAAGCTAGCCGAGGAAAAGAGGGCCACGATCGAAGC
CAAACGAGGCGAAGATATGCTAAAGGCGGAGGAGAGGGCTGCAAAGTACCGTGCTACAGGGACGACTCCCAAGAACCCACTTGGCTTCGGTTGCTTCAAA
TAA
AA sequence
>Lus10027460 pacid=23144593 polypeptide=Lus10027460 locus=Lus10027460.g ID=Lus10027460.BGIv1.0 annot-version=v1.0
MAEEEAKKLVPESPASAVVEPPKDVAEEKSVIPTPPSEDKSDPKPDDDSSKAIVPLQKEAEPVSEEAKPVEGSVNRDLELARVETEKRLSFIKAWEESEK
SKAENKAHKKVSAIESWENSKKAAVEAQLRQFEEKLEKQKAEYAEKMKNKIAEIHKLAEEKRATIEAKRGEDMLKAEERAAKYRATGTTPKNPLGFGCFK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G61260 Remorin family protein (.1) Lus10027460 0 1
AT3G61260 Remorin family protein (.1) Lus10039215 1.0 0.8627
AT2G33205 Serinc-domain containing serin... Lus10023690 3.3 0.7860
AT5G23870 Pectinacetylesterase family pr... Lus10039238 4.0 0.8006
AT3G09740 ATSYP71, SYP71 syntaxin of plants 71 (.1) Lus10019925 5.2 0.8116
AT3G23340 CKL10 casein kinase I-like 10 (.1) Lus10014661 6.0 0.7757
Lus10019921 7.2 0.8284
AT2G43430 GLY1, GLX2-1 GLYOXALASE II, glyoxalase 2-1 ... Lus10033662 7.5 0.7737
Lus10028745 9.7 0.7423
AT3G59350 Protein kinase superfamily pro... Lus10025496 12.2 0.7869
AT5G03040 IQD2 IQ-domain 2 (.1.2.3) Lus10019916 13.5 0.7827

Lus10027460 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.