Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G16860 57 / 4e-11 GCIP-interacting family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039220 [exp] 60 / 2e-12 AT2G16860 421 / 1e-149 GCIP-interacting family protein (.1) Lus10027464 [exp] 60 / 3e-12 AT2G16860 416 / 1e-147 GCIP-interacting family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G176200 [exp] 50 / 1e-08 AT2G16860 408 / 2e-144 GCIP-interacting family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027466 pacid=23144523 polypeptide=Lus10027466 locus=Lus10027466.g ID=Lus10027466.BGIv1.0 annot-version=v1.0 ATGAAAGAAGCTGATCCTGAGTTCTACCGTGATGCCTCGAGTCTATATTGCGGGAAGGCCTTAAGAGGACAAGAATGGCATAATGGTGAAGGAAGGAACA CAGTGACTGGGACAAGAAGAGCAAGGTCTTCTAACCGGATGAAAGAGTTCCTCGAGGAGAAAGATATCGAATCGATCAATGATGGTAAAGAGTCCTTGAA CAGGAAGATAGAATGA
AA sequence Show only first row Show all	>Lus10027466 pacid=23144523 polypeptide=Lus10027466 locus=Lus10027466.g ID=Lus10027466.BGIv1.0 annot-version=v1.0 MKEADPEFYRDASSLYCGKALRGQEWHNGEGRNTVTGTRRARSSNRMKEFLEEKDIESINDGKESLNRKIE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G16860			GCIP-interacting family protei...		Lus10027466 [exp]	0	1
AT1G53200			unknown protein		Lus10030239 [exp]	5.3	0.8498
AT3G19184	B3		AP2/B3-like transcriptional fa...		Lus10031022 [exp]	9.8	0.8143
AT5G61830			NAD(P)-binding Rossmann-fold s...		Lus10032525 [exp]	11.1	0.8545
AT2G41760			unknown protein		Lus10007544 [exp]	12.1	0.7918
AT2G28085			SAUR-like auxin-responsive pro...		Lus10001397 [exp]	14.7	0.8185
AT3G53500		RSZ32, RS2Z32, ...	arginine/serine-rich zinc knuc...		Lus10009067 [exp]	17.8	0.8251
AT5G10700			Peptidyl-tRNA hydrolase II (PT...		Lus10020143 [exp]	19.3	0.8170
AT1G43860			sequence-specific DNA binding ...		Lus10042780 [exp]	27.9	0.8246
					Lus10007667 [exp]	37.8	0.8054
AT1G22140			unknown protein		Lus10025627 [exp]	42.4	0.7969

Compare expression of checked genes

Lus10027466 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.