Lus10027474 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G52360 244 / 6e-85 ADF10 actin depolymerizing factor 10 (.1)
AT4G25590 244 / 8e-85 ADF7 actin depolymerizing factor 7 (.1)
AT1G01750 238 / 3e-82 ADF11 actin depolymerizing factor 11 (.1)
AT4G00680 236 / 1e-81 ADF8 actin depolymerizing factor 8 (.1)
AT3G46000 226 / 1e-77 ADF2 actin depolymerizing factor 2 (.1)
AT5G59890 225 / 2e-77 ADF4, ATADF4 actin depolymerizing factor 4 (.1.2)
AT3G46010 224 / 5e-77 ATADF1, ADF1 actin depolymerizing factor 1 (.1.2)
AT5G59880 211 / 1e-71 ADF3 actin depolymerizing factor 3 (.1.2)
AT2G31200 171 / 1e-55 ADF6, ATADF6 actin depolymerizing factor 6 (.1)
AT2G16700 160 / 1e-51 ADF5, ATADF5 actin depolymerizing factor 5 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039229 270 / 4e-95 AT5G52360 231 / 6e-80 actin depolymerizing factor 10 (.1)
Lus10038859 247 / 4e-86 AT4G25590 232 / 2e-80 actin depolymerizing factor 7 (.1)
Lus10014977 246 / 2e-85 AT4G25590 233 / 1e-80 actin depolymerizing factor 7 (.1)
Lus10024418 223 / 2e-76 AT5G59890 249 / 6e-87 actin depolymerizing factor 4 (.1.2)
Lus10024417 219 / 1e-74 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2)
Lus10025319 219 / 1e-74 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2)
Lus10023428 216 / 8e-71 AT5G59890 244 / 4e-81 actin depolymerizing factor 4 (.1.2)
Lus10040307 214 / 2e-70 AT5G59890 243 / 2e-81 actin depolymerizing factor 4 (.1.2)
Lus10008489 182 / 5e-60 AT1G01750 192 / 2e-64 actin depolymerizing factor 11 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G141600 245 / 3e-85 AT4G25590 254 / 5e-89 actin depolymerizing factor 7 (.1)
Potri.015G144500 243 / 2e-84 AT4G25590 257 / 6e-90 actin depolymerizing factor 7 (.1)
Potri.001G236700 232 / 4e-80 AT5G59890 256 / 2e-89 actin depolymerizing factor 4 (.1.2)
Potri.008G052100 231 / 9e-80 AT5G59890 249 / 1e-86 actin depolymerizing factor 4 (.1.2)
Potri.001G106200 231 / 1e-79 AT4G00680 234 / 6e-81 actin depolymerizing factor 8 (.1)
Potri.009G028100 231 / 1e-79 AT5G59890 256 / 1e-89 actin depolymerizing factor 4 (.1.2)
Potri.003G125500 228 / 2e-78 AT4G00680 234 / 1e-80 actin depolymerizing factor 8 (.1)
Potri.009G028200 227 / 4e-78 AT5G59890 258 / 4e-90 actin depolymerizing factor 4 (.1.2)
Potri.001G236400 226 / 1e-77 AT5G59890 246 / 1e-85 actin depolymerizing factor 4 (.1.2)
Potri.010G208500 222 / 4e-76 AT5G59890 255 / 4e-89 actin depolymerizing factor 4 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0092 ADF PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Representative CDS sequence
>Lus10027474 pacid=23144514 polypeptide=Lus10027474 locus=Lus10027474.g ID=Lus10027474.BGIv1.0 annot-version=v1.0
ATGGCAAACTCGGCATCAGGAATGGCAGTCCACGACGACTGCAAGCTCAAGTTTTTGGAACTGAAAGCAAAGAGGAACTACAGGTTCATAGTTTTCAAGA
TCTTGAACCAGCAGGTTTCTGTAGAGAAACTCGGGAGCCCCGAGGAGACGTACGAGGATTTCACCTCATCCTTGCCCCCGAACGAGTGTCGATATGCTGT
CTACGACTTTGATTTCACCACCGATGAGAACTGCCAGAAGAGCAAGATCTTCTTCATTGCATGGGCACCTGATATATCCAAGGTGAGGGAAAAGATGGTG
TACGCTAGCTCGAAAGATCGATTCAAGAGGGAACTGGATGGGATTCAAGTAGAGCTACAAGCCACTGATCCCAGCGAAATGAGCCTCGACATTGTCAAAG
GCCGAGCTCTTTAG
AA sequence
>Lus10027474 pacid=23144514 polypeptide=Lus10027474 locus=Lus10027474.g ID=Lus10027474.BGIv1.0 annot-version=v1.0
MANSASGMAVHDDCKLKFLELKAKRNYRFIVFKILNQQVSVEKLGSPEETYEDFTSSLPPNECRYAVYDFDFTTDENCQKSKIFFIAWAPDISKVREKMV
YASSKDRFKRELDGIQVELQATDPSEMSLDIVKGRAL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G52360 ADF10 actin depolymerizing factor 10... Lus10027474 0 1
AT3G52500 Eukaryotic aspartyl protease f... Lus10013324 5.3 0.8011
AT4G37680 HHP4 heptahelical protein 4 (.1.2) Lus10011713 8.0 0.8467
AT1G68670 GARP myb-like transcription factor ... Lus10035043 12.5 0.7999
AT3G07490 AtCML3, AGD11 calmodulin-like 3, ARF-GAP dom... Lus10009564 20.0 0.8000
AT2G39290 PGP1, PGS1, PGP... phosphatidylglycerolphosphate ... Lus10023471 26.5 0.7553
AT3G47420 AtG3Pp1, ATPS3 Glycerol-3-phosphate permease ... Lus10031153 28.4 0.7630
AT3G16180 Major facilitator superfamily ... Lus10014537 29.7 0.7559
AT5G53750 CBS domain-containing protein ... Lus10029665 32.4 0.7754
AT2G43060 bHLH AtIBH1, bHLH158 ILI1 binding bHLH 1 (.1) Lus10025511 38.3 0.7799
AT1G64450 Glycine-rich protein family (.... Lus10003189 39.2 0.7687

Lus10027474 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.