Lus10027477 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G48990 353 / 1e-121 AMP-dependent synthetase and ligase family protein (.1)
AT4G05160 141 / 1e-39 AMP-dependent synthetase and ligase family protein (.1)
AT4G19010 126 / 5e-34 AMP-dependent synthetase and ligase family protein (.1)
AT3G21230 124 / 4e-33 4CL5 4-coumarate:CoA ligase 5 (.1)
AT3G21240 122 / 1e-32 AT4CL2, 4CL2 4-coumarate:CoA ligase 2 (.1)
AT1G20480 122 / 2e-32 AMP-dependent synthetase and ligase family protein (.1)
AT1G20560 121 / 2e-32 AAE1 acyl activating enzyme 1 (.1.2)
AT1G20510 121 / 3e-32 OPCL1 OPC-8:0 CoA ligase1 (.1.2)
AT1G20500 120 / 9e-32 AMP-dependent synthetase and ligase family protein (.1)
AT3G16910 113 / 3e-29 AAE7, ACN1 ACETATE NON-UTILIZING 1, acyl-activating enzyme 7 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039232 398 / 5e-139 AT3G48990 840 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Lus10016135 137 / 8e-38 AT4G05160 791 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Lus10021431 135 / 4e-37 AT4G05160 803 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Lus10013831 134 / 1e-36 AT4G05160 654 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Lus10026544 130 / 2e-35 AT4G05160 642 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Lus10026143 120 / 7e-32 AT1G51680 838 / 0.0 ARABIDOPSIS THALIANA 4-COUMARATE:COA LIGASE 1, 4-coumarate:CoA ligase 1 (.1.2.3)
Lus10016630 119 / 1e-31 AT4G19010 532 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Lus10002791 120 / 2e-31 AT5G63380 688 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Lus10012266 119 / 2e-31 AT5G16370 733 / 0.0 acyl activating enzyme 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G144700 340 / 3e-116 AT3G48990 776 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.001G105900 337 / 3e-115 AT3G48990 750 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.004G102000 134 / 6e-37 AT4G05160 826 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.017G112800 134 / 8e-37 AT4G05160 852 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.017G138350 127 / 2e-34 AT1G65880 724 / 0.0 benzoyloxyglucosinolate 1 (.1)
Potri.006G169700 127 / 4e-34 AT3G21240 802 / 0.0 4-coumarate:CoA ligase 2 (.1)
Potri.004G082000 126 / 6e-34 AT1G65880 724 / 0.0 benzoyloxyglucosinolate 1 (.1)
Potri.010G230200 126 / 7e-34 AT1G20510 478 / 7e-164 OPC-8:0 CoA ligase1 (.1.2)
Potri.012G095000 124 / 2e-33 AT5G63380 615 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.017G138451 124 / 4e-33 AT1G65880 730 / 0.0 benzoyloxyglucosinolate 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0378 ANL PF00501 AMP-binding AMP-binding enzyme
Representative CDS sequence
>Lus10027477 pacid=23144595 polypeptide=Lus10027477 locus=Lus10027477.g ID=Lus10027477.BGIv1.0 annot-version=v1.0
ATGTCGTCGAACCCATTGCCCGAAGACGGTCCACATAAACCCGGGTCGGTCGGGAAACCAGTTGGTCAAGAGATGGCGATCCTGGATGAAAGTGGCGCGA
TTCAGGGCCCCGATTCCAAAGGTGAAGTCTGCATTAGAGGTCCAAATGTGACCAAGGGATACAAGAACAACCCTGATGCTAACAAGGCAGGATTCCTATT
CGGGTGGTTTCATACCGGAGATATCGGTTATTTCGACTCGGATGGTTATTTGAATCTTGTGGGCAGGATTAAGGAGCTTATCAACCGTGGAGGGGAGAAG
ATATCACCAATCGAAGTGGACGCTGTTCTTCTATCTCATCCAGACATTGCTCAAGCTGTATGTTTCGGAGTCCCCGATGAGAAATACGGCGAAGAGATAA
ACTGTGCAATCATACCAAGAGAAGGATCGAAGATCGACGAGGCAGAGGTGCAGAGCTTCTGCAAGAAGAACCTGGCCGCCTTCAAGGTCCCGAAGAAGGT
GTTCATCACGGACGATGTTCCGAAGACGGCCAGTGGTAAGATCCAGAGAAGAATTGTGGCTCAGCACTTCATCTCTTGA
AA sequence
>Lus10027477 pacid=23144595 polypeptide=Lus10027477 locus=Lus10027477.g ID=Lus10027477.BGIv1.0 annot-version=v1.0
MSSNPLPEDGPHKPGSVGKPVGQEMAILDESGAIQGPDSKGEVCIRGPNVTKGYKNNPDANKAGFLFGWFHTGDIGYFDSDGYLNLVGRIKELINRGGEK
ISPIEVDAVLLSHPDIAQAVCFGVPDEKYGEEINCAIIPREGSKIDEAEVQSFCKKNLAAFKVPKKVFITDDVPKTASGKIQRRIVAQHFIS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G48990 AMP-dependent synthetase and l... Lus10027477 0 1
AT1G50420 GRAS SCL-3, SCL3 scarecrow-like 3 (.1) Lus10009717 2.2 0.9228
AT3G52880 ATMDAR1 monodehydroascorbate reductase... Lus10008633 3.3 0.9116
AT3G05200 ATL6 RING/U-box superfamily protein... Lus10029949 4.0 0.9332
AT3G09270 ATGSTU8 glutathione S-transferase TAU ... Lus10001491 5.3 0.9447
AT3G25160 ER lumen protein retaining rec... Lus10003146 8.4 0.9123
AT1G68765 IDA INFLORESCENCE DEFICIENT IN ABS... Lus10034260 8.8 0.8903
AT2G02870 Galactose oxidase/kelch repeat... Lus10012841 9.5 0.8931
Lus10018014 10.6 0.9185
AT5G20900 ZIM TIFY3B, JAZ12 jasmonate-zim-domain protein 1... Lus10027639 10.7 0.8967
AT3G02130 TOAD2, RPK2, CL... TOADSTOOL 2, clv3 peptide inse... Lus10026666 11.8 0.9060

Lus10027477 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.