Lus10027478 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G48990 405 / 1e-139 AMP-dependent synthetase and ligase family protein (.1)
AT1G20510 71 / 2e-13 OPCL1 OPC-8:0 CoA ligase1 (.1.2)
AT4G19010 65 / 1e-11 AMP-dependent synthetase and ligase family protein (.1)
AT1G65060 64 / 3e-11 4CL3 4-coumarate:CoA ligase 3 (.1.2)
AT5G38120 64 / 4e-11 4CL8 AMP-dependent synthetase and ligase family protein (.1)
AT1G20490 63 / 6e-11 AMP-dependent synthetase and ligase family protein (.1)
AT3G16170 63 / 7e-11 AAE13 acyl activating enzyme 13, AMP-dependent synthetase and ligase family protein (.1)
AT4G05160 62 / 1e-10 AMP-dependent synthetase and ligase family protein (.1)
AT1G20480 62 / 2e-10 AMP-dependent synthetase and ligase family protein (.1)
AT3G21230 59 / 1e-09 4CL5 4-coumarate:CoA ligase 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039232 514 / 0 AT3G48990 840 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Lus10024123 67 / 4e-12 AT3G21240 835 / 0.0 4-coumarate:CoA ligase 2 (.1)
Lus10008677 66 / 1e-11 AT1G51680 834 / 0.0 ARABIDOPSIS THALIANA 4-COUMARATE:COA LIGASE 1, 4-coumarate:CoA ligase 1 (.1.2.3)
Lus10026143 65 / 3e-11 AT1G51680 838 / 0.0 ARABIDOPSIS THALIANA 4-COUMARATE:COA LIGASE 1, 4-coumarate:CoA ligase 1 (.1.2.3)
Lus10012280 64 / 3e-11 AT1G20510 825 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Lus10005390 62 / 1e-10 AT1G51680 827 / 0.0 ARABIDOPSIS THALIANA 4-COUMARATE:COA LIGASE 1, 4-coumarate:CoA ligase 1 (.1.2.3)
Lus10027377 62 / 2e-10 AT4G05160 95 / 2e-19 AMP-dependent synthetase and ligase family protein (.1)
Lus10015998 61 / 4e-10 AT1G20510 833 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Lus10016135 60 / 7e-10 AT4G05160 791 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G144700 426 / 9e-148 AT3G48990 776 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.001G105900 355 / 5e-120 AT3G48990 750 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.001G036900 74 / 1e-14 AT3G21240 768 / 0.0 4-coumarate:CoA ligase 2 (.1)
Potri.005G248500 74 / 2e-14 AT1G20510 795 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Potri.003G188500 74 / 2e-14 AT3G21240 741 / 0.0 4-coumarate:CoA ligase 2 (.1)
Potri.006G169700 71 / 3e-13 AT3G21240 802 / 0.0 4-coumarate:CoA ligase 2 (.1)
Potri.018G094200 70 / 5e-13 AT3G21240 807 / 0.0 4-coumarate:CoA ligase 2 (.1)
Potri.019G049500 70 / 6e-13 AT1G65060 781 / 0.0 4-coumarate:CoA ligase 3 (.1.2)
Potri.003G099700 69 / 8e-13 AT4G19010 634 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.010G230200 69 / 1e-12 AT1G20510 478 / 7e-164 OPC-8:0 CoA ligase1 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0378 ANL PF00501 AMP-binding AMP-binding enzyme
Representative CDS sequence
>Lus10027478 pacid=23144504 polypeptide=Lus10027478 locus=Lus10027478.g ID=Lus10027478.BGIv1.0 annot-version=v1.0
ATGGAGACGACTCAAACTCTCACTGGATTGCTCAAACGCGTCGCCGGCGACTTCCCCGACCGCCGAGCGCTCTCTGTCTCCGGCAAGTTCGATCTTACTC
ACGCTCGTCTCGATGAACTCGTCGAACGCGCCGCCTCTCGCCTCGTCTCCGCCGGAATCAAGCCCGGGGACGTCGTCGCCCTCACGTTCCCCAACACCGT
CGAGTTCGTGGTGATGTTTTTGGCTGTGATTCGAGCCAGAGCCACCGCAGCTCCGCTCAACGCCGCCTACACGGCGGAGGAATTCGAGTTCTACCTATCT
GACTCAGAATCGAAGCTACTGCTTACTTCGCGAGACGGAAACGCGGCAGCGGAAGCCGCCGCTTCCAAGCTACAAGTTACTCACGTCACCGCCGGTCTTA
CCAGCGAAGACTTAGAACTCATCCTCTCTCTTCCTCCGTCCGAGACGGGAGATAACTCGATAACTCAGCTGGTGAATGATCCGTCCGATGTGGCACTCTT
CCTTCATACCTCCGGAACCACCAGCAGGCCCAAGGGAGTTCCATTGACTCAGCTCAATTTGGCCTCATCCGTACAGAACATTAAGTCAGTGTACAAGCTC
ACAGAGTCAGACTCGACCGTGATTGTCCTGCCATTGTTTCATGTGCATGGATTGTTAGCAGGGCTATTGAGTTCATTTGTGGCTGGAGCTGCTGTGACAC
TGCCAGCTTCTGGTCGATTCTCTGCTTCAACATTTTGGCAGGACATGTTGAAGTACAATGCTACTTGGTACACAGCAGTTCCCACCATTCACCAGATCAT
ACTGGACCGCCATGCAAGTAGCCCAGAGCCTGTTTACCCGAAGCTTCGATTCATTCGTAGCTGCAGCGCTTCACTTGCGCTTCACTTTCCCCGTCGATAT
TGGCTAGGCTCGAGGAGGCATTTGGAGCACCGGTTCTGGAGGCCTATGCAATGA
AA sequence
>Lus10027478 pacid=23144504 polypeptide=Lus10027478 locus=Lus10027478.g ID=Lus10027478.BGIv1.0 annot-version=v1.0
METTQTLTGLLKRVAGDFPDRRALSVSGKFDLTHARLDELVERAASRLVSAGIKPGDVVALTFPNTVEFVVMFLAVIRARATAAPLNAAYTAEEFEFYLS
DSESKLLLTSRDGNAAAEAAASKLQVTHVTAGLTSEDLELILSLPPSETGDNSITQLVNDPSDVALFLHTSGTTSRPKGVPLTQLNLASSVQNIKSVYKL
TESDSTVIVLPLFHVHGLLAGLLSSFVAGAAVTLPASGRFSASTFWQDMLKYNATWYTAVPTIHQIILDRHASSPEPVYPKLRFIRSCSASLALHFPRRY
WLGSRRHLEHRFWRPMQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G48990 AMP-dependent synthetase and l... Lus10027478 0 1
AT2G01140 PDE345 PIGMENT DEFECTIVE 345, Aldolas... Lus10035247 3.9 0.9109
AT1G63830 PLAC8 family protein (.1.2.3) Lus10017509 6.0 0.9156
AT1G07940 GTP binding Elongation factor ... Lus10040378 6.8 0.8909
AT1G11050 Protein kinase superfamily pro... Lus10028549 21.2 0.9067
AT1G15530 Concanavalin A-like lectin pro... Lus10019879 29.1 0.9105
AT2G01140 PDE345 PIGMENT DEFECTIVE 345, Aldolas... Lus10034619 35.9 0.9040
AT5G53300 UBC10 ubiquitin-conjugating enzyme 1... Lus10033937 48.0 0.8486
AT4G34710 SPE2, ADC2, ATA... arginine decarboxylase 2 (.1.2... Lus10031079 48.6 0.9039
AT1G21380 Target of Myb protein 1 (.1) Lus10029739 54.0 0.8891
AT4G35630 PSAT phosphoserine aminotransferase... Lus10039587 59.7 0.8675

Lus10027478 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.