Lus10027481 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G52400 206 / 9e-64 CYP715A1 "cytochrome P450, family 715, subfamily A, polypeptide 1", cytochrome P450, family 715, subfamily A, polypeptide 1 (.1)
AT1G67110 129 / 1e-34 CYP735A2 "cytochrome P450, family 735, subfamily A, polypeptide 2", cytochrome P450, family 735, subfamily A, polypeptide 2 (.1)
AT2G26710 127 / 4e-34 CYP72B1, CYP734A1, BAS1 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1)
AT5G38450 126 / 1e-33 CYP735A1 "cytochrome P450, family 735, subfamily A, polypeptide 1", cytochrome P450, family 735, subfamily A, polypeptide 1 (.1)
AT5G24900 123 / 1e-32 ELA2, CYP714A2 EUI-like p450 A2, cytochrome P450, family 714, subfamily A, polypeptide 2 (.1)
AT5G24910 122 / 2e-32 ELA1, CYP714A1 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1)
AT1G17060 118 / 5e-31 SHK1, CHI2, SOB7, CYP72C1 SUPPRESSOR OF PHYB-4 7, SHRINK 1, CHIBI 2, cytochrome p450 72c1 (.1)
AT3G14610 116 / 4e-30 CYP72A7 "cytochrome P450, family 72, subfamily A, polypeptide 7", cytochrome P450, family 72, subfamily A, polypeptide 7 (.1)
AT3G14630 115 / 1e-29 CYP72A9 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1)
AT3G14680 115 / 1e-29 CYP72A14 "cytochrome P450, family 72, subfamily A, polypeptide 14", cytochrome P450, family 72, subfamily A, polypeptide 14 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039234 268 / 2e-87 AT5G52400 653 / 0.0 "cytochrome P450, family 715, subfamily A, polypeptide 1", cytochrome P450, family 715, subfamily A, polypeptide 1 (.1)
Lus10017595 134 / 2e-36 AT5G38450 697 / 0.0 "cytochrome P450, family 735, subfamily A, polypeptide 1", cytochrome P450, family 735, subfamily A, polypeptide 1 (.1)
Lus10033555 132 / 6e-36 AT5G38450 694 / 0.0 "cytochrome P450, family 735, subfamily A, polypeptide 1", cytochrome P450, family 735, subfamily A, polypeptide 1 (.1)
Lus10025756 128 / 2e-34 AT2G46950 578 / 0.0 "cytochrome P450, family 709, subfamily B, polypeptide 2", cytochrome P450, family 709, subfamily B, polypeptide 2 (.1)
Lus10025755 127 / 1e-33 AT1G80300 923 / 0.0 nucleotide transporter 1 (.1)
Lus10017771 123 / 1e-32 AT2G26710 705 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1)
Lus10008423 122 / 4e-32 AT5G24910 462 / 9e-159 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1)
Lus10033044 121 / 7e-32 AT2G26710 803 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1)
Lus10010821 117 / 1e-30 AT1G75130 522 / 0.0 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G145100 230 / 5e-73 AT5G52400 646 / 0.0 "cytochrome P450, family 715, subfamily A, polypeptide 1", cytochrome P450, family 715, subfamily A, polypeptide 1 (.1)
Potri.012G142000 214 / 6e-67 AT5G52400 622 / 0.0 "cytochrome P450, family 715, subfamily A, polypeptide 1", cytochrome P450, family 715, subfamily A, polypeptide 1 (.1)
Potri.017G114200 126 / 1e-33 AT5G38450 724 / 0.0 "cytochrome P450, family 735, subfamily A, polypeptide 1", cytochrome P450, family 735, subfamily A, polypeptide 1 (.1)
Potri.011G098800 123 / 1e-32 AT3G14690 640 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1)
Potri.006G154500 123 / 2e-32 AT2G26710 789 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1)
Potri.013G160800 122 / 2e-32 AT5G24910 468 / 6e-161 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1)
Potri.018G070900 122 / 3e-32 AT2G26710 796 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1)
Potri.011G101500 121 / 8e-32 AT3G14690 609 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1)
Potri.011G101401 120 / 1e-31 AT3G14690 613 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1)
Potri.011G099800 120 / 1e-31 AT3G14690 612 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00067 p450 Cytochrome P450
Representative CDS sequence
>Lus10027481 pacid=23144540 polypeptide=Lus10027481 locus=Lus10027481.g ID=Lus10027481.BGIv1.0 annot-version=v1.0
ATGGGTTGGGTAATGAACGAAGTCCTTCGACTCTACTCGCCGGCACCGAACGTACAACGACAAGCGAAAGAAGACATAAAAGTCAACGGCCGGACCATTC
CGAAGGGGACAAACATGTGGATCGATGTCGTCGCGATGCACCACGACCGTACCCTGTGGGGGGATGACGTGTACGAGTTCAAGCCGGAGCGGTTCAAGGC
GGACCCGCTGTACGGAGGGTGCAAGCACAAGATGGGGTTCATGCCGTTCGGGTTTGGAGGCCGAATGTGCGTCGGGAGGAACTTGACGATGATGGAGTAC
AAGATCGTGTTGTCGTTGATTTTGACGAGGTTTTCGTTCTCGTTGTCTCCTTCGTATGATCACTCTCCGGCGATTGTCCTCTCCTTGAGGCCCTCCCACG
GCGTTCCTCTCGTGCTCCGGCCGTTGGCATATGCAGAGTTCCAAACCAAGTTGCAGACTTTTAGAGGCCATAACAATCACAGAATTGCTTCTGGGTGGCC
ACAATTATCAAATTGGTTTCAATCAGTAACGGACATAACAAATCTGGAAATCGGTTCACGAATCGGAGGCTTTCAGGAGGTCTTCGCCTTTGATCTGAGG
GAGCTCGTAAGCTTGCGTCGGAGGGTCTTCTCCATCTCAGTCGCCGGTGCTCACGACTGA
AA sequence
>Lus10027481 pacid=23144540 polypeptide=Lus10027481 locus=Lus10027481.g ID=Lus10027481.BGIv1.0 annot-version=v1.0
MGWVMNEVLRLYSPAPNVQRQAKEDIKVNGRTIPKGTNMWIDVVAMHHDRTLWGDDVYEFKPERFKADPLYGGCKHKMGFMPFGFGGRMCVGRNLTMMEY
KIVLSLILTRFSFSLSPSYDHSPAIVLSLRPSHGVPLVLRPLAYAEFQTKLQTFRGHNNHRIASGWPQLSNWFQSVTDITNLEIGSRIGGFQEVFAFDLR
ELVSLRRRVFSISVAGAHD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G52400 CYP715A1 "cytochrome P450, family 715, ... Lus10027481 0 1
AT2G47140 AtSDR5 short-chain dehydrogenase redu... Lus10016991 3.5 0.9823
AT3G12500 PR-3, PR3, CHI-... PATHOGENESIS-RELATED 3, basic ... Lus10028378 3.9 0.9796
AT5G67550 unknown protein Lus10025583 5.1 0.9810
AT1G30370 DLAH DAD1-like acylhydrolase, alpha... Lus10038526 10.2 0.9646
AT5G52400 CYP715A1 "cytochrome P450, family 715, ... Lus10039234 14.1 0.9558
AT3G61510 AT-ACS1, ACS1 ARABIDOPSIS THALIANA 1-AMINOCY... Lus10036396 17.3 0.9687
AT1G78410 VQ motif-containing protein (.... Lus10023308 17.6 0.9498
AT3G22880 ARLIM15, ATDMC1 ARABIDOPSIS THALIANA DISRUPTIO... Lus10039383 18.2 0.9623
AT3G12500 PR-3, PR3, CHI-... PATHOGENESIS-RELATED 3, basic ... Lus10041830 19.0 0.9680
AT3G51680 AtSDR2 short-chain dehydrogenase/redu... Lus10021312 20.2 0.9608

Lus10027481 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.