Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039242 [exp] 63 / 4e-15 ND 33 / 0.009
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G178400 [exp] 56 / 4e-12 ND / Potri.002G159800 [exp] 38 / 5e-05 ND / Potri.014G084350 [exp] 37 / 9e-05 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027487 pacid=23144455 polypeptide=Lus10027487 locus=Lus10027487.g ID=Lus10027487.BGIv1.0 annot-version=v1.0 ATGGACGGTGTGACGGATGGAACAGAAGGCGGTGGCGGGAAGAAGAAGGTAGCTCCGGCGTGCGATGTGGAGGGACTGAAGAAGTGCTTGGAGGAGAACA AGGGTAACTACGCGAAATGTCAATCGCAGATTGAAGCTTTCAAGTCATCGTGTTCGATAAAGAAACCATCTCCGTCATCGGCGGCGGAACCTAAGACCAC CGCATAG
AA sequence Show only first row Show all	>Lus10027487 pacid=23144455 polypeptide=Lus10027487 locus=Lus10027487.g ID=Lus10027487.BGIv1.0 annot-version=v1.0 MDGVTDGTEGGGGKKKVAPACDVEGLKKCLEENKGNYAKCQSQIEAFKSSCSIKKPSPSSAAEPKTTA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10027487 [exp]	0	1
AT2G02880			mucin-related (.1)		Lus10030486 [exp]	8.7	0.7246
					Lus10039242 [exp]	13.7	0.6581
AT2G02880			mucin-related (.1)		Lus10012838 [exp]	22.3	0.7059
AT5G10990			SAUR-like auxin-responsive pro...		Lus10026297 [exp]	25.9	0.5950
AT3G19895			RING/U-box superfamily protein...		Lus10034201 [exp]	27.4	0.6930
AT1G76060		EMB1793	EMBRYO DEFECTIVE 1793, LYR fam...		Lus10017248 [exp]	29.3	0.6463
AT1G50300		TAF15	TBP-associated factor 15 (.1)		Lus10012902 [exp]	38.7	0.6377
AT2G29590			Thioesterase superfamily prote...		Lus10040701 [exp]	46.6	0.5477
AT1G03650			Acyl-CoA N-acyltransferases (N...		Lus10025567 [exp]	46.8	0.6502
AT4G14880		OLD3, CYTACS1, ...	ONSET OF LEAF DEATH 3, O-acety...		Lus10019003 [exp]	47.9	0.6536

Compare expression of checked genes

Lus10027487 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.