Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G11840 156 / 1e-48 Protein of unknown function (DUF1230) (.1) AT5G67370 107 / 3e-29 Protein of unknown function (DUF1230) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039247 [exp] 231 / 4e-78 AT5G11840 287 / 1e-97 Protein of unknown function (DUF1230) (.1) Lus10011087 [exp] 108 / 2e-29 AT5G67370 388 / 6e-136 Protein of unknown function (DUF1230) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G229600 [exp] 181 / 2e-58 AT5G11840 303 / 4e-104 Protein of unknown function (DUF1230) (.1) Potri.007G052500 [exp] 109 / 5e-30 AT5G67370 391 / 3e-137 Protein of unknown function (DUF1230) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06799 [flax] [poplar] DUF1230 Conserved in the green lineage and diatoms 27
Representative CDS sequence Show only first row Show all	>Lus10027492 pacid=23144449 polypeptide=Lus10027492 locus=Lus10027492.g ID=Lus10027492.BGIv1.0 annot-version=v1.0 ATGTATTTGGGCTGGGCTTACGTTGGGAACCGTTTGCTCAGCGCCACCGTTGAGTATGAAGAAACCGGCTGGTACGACGGCCAGATATGGGTGAAGACTG CAGAAGTGTTGACTAGAGACCGGCTGCTTGGTTCTATTACTGTGAAGCCAGTACTAAGCAGACTGAAGAACACTCTGGTGACGCTAGCGGCAATGCTTGT TGCTTGTGTTCTTCTCTTCATCAGTTTAGAGAGGGAGGCAATGGATTCAAGCAGACTCTCTGAAGCGGGAGGAGGAGGAGGAGGTAGAGCTGTGTCTGGA GCTTACAACGATGATTCGGCGAGATCATTCGAGCCGGATGCTTTCTGTGGTGAACCAAGTGAAACAATGTGA
AA sequence Show only first row Show all	>Lus10027492 pacid=23144449 polypeptide=Lus10027492 locus=Lus10027492.g ID=Lus10027492.BGIv1.0 annot-version=v1.0 MYLGWAYVGNRLLSATVEYEETGWYDGQIWVKTAEVLTRDRLLGSITVKPVLSRLKNTLVTLAAMLVACVLLFISLEREAMDSSRLSEAGGGGGGRAVSG AYNDDSARSFEPDAFCGEPSETM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G11840			Protein of unknown function (D...		Lus10027492 [exp]	0	1
AT5G57345			unknown protein		Lus10001632 [exp]	3.2	0.9348
AT1G77090			Mog1/PsbP/DUF1795-like photosy...		Lus10028633 [exp]	4.6	0.9232
AT5G57345			unknown protein		Lus10001438 [exp]	6.0	0.9250
AT3G63520		ATNCED1, ATCCD1...	carotenoid cleavage dioxygenas...		Lus10029513 [exp]	6.5	0.9188
AT5G05200			Protein kinase superfamily pro...		Lus10012864 [exp]	8.1	0.9126
AT3G02730		TRXF1, ATF1	thioredoxin F-type 1 (.1)		Lus10026999 [exp]	9.4	0.9204
AT1G05140			Peptidase M50 family protein (...		Lus10027190 [exp]	9.5	0.9201
AT5G08410		FTRA2	ferredoxin/thioredoxin reducta...		Lus10041002 [exp]	11.8	0.9139
AT2G35810			unknown protein		Lus10023491 [exp]	12.4	0.8969
AT4G16380			Heavy metal transport/detoxifi...		Lus10000039 [exp]	12.6	0.8989

Compare expression of checked genes

Lus10027492 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.