Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G52420 47 / 1e-07 unknown protein AT1G27990 45 / 6e-07 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039248 [exp] 100 / 2e-27 AT5G52420 212 / 8e-69 unknown protein Lus10039249 [exp] 56 / 1e-10 AT5G52420 160 / 2e-49 unknown protein Lus10027495 [exp] 56 / 1e-10 AT5G52420 159 / 8e-49 unknown protein Lus10037043 [exp] 45 / 2e-06 AT1G27990 306 / 2e-105 unknown protein Lus10015763 [exp] 44 / 3e-06 AT1G27990 302 / 5e-104 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G146400 [exp] 59 / 1e-11 AT5G52420 259 / 3e-87 unknown protein Potri.001G059500 [exp] 49 / 6e-08 AT1G27990 308 / 7e-106 unknown protein Potri.003G168400 [exp] 43 / 5e-06 AT1G27990 318 / 5e-109 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027493 pacid=23144624 polypeptide=Lus10027493 locus=Lus10027493.g ID=Lus10027493.BGIv1.0 annot-version=v1.0 ATGTCAGGAGGAGTCGGGCCAAGCGCAGACATTTCCCTACCGAAAGACCAACCCGAATCCGAACAAGGCCACAAGCTCATCCAAGACCACCACCCACCGA AATCGGAAGGAGTTGGTGGGGCCGGGGGGGAGGGGAGGTTGTGGTTTGGGAGAGGGTTGGCGGTGGCGAACTTGGGGTTTTGGGGGATTAATCTGTTTGG GTTTCTGTTGCCGGTGGCGGTTCCGATTTGTATGAAGAAGTATTACTCTGCTTCTCTCCAGATTAAGGCCTCCAAAGATTGA
AA sequence Show only first row Show all	>Lus10027493 pacid=23144624 polypeptide=Lus10027493 locus=Lus10027493.g ID=Lus10027493.BGIv1.0 annot-version=v1.0 MSGGVGPSADISLPKDQPESEQGHKLIQDHHPPKSEGVGGAGGEGRLWFGRGLAVANLGFWGINLFGFLLPVAVPICMKKYYSASLQIKASKD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G52420			unknown protein		Lus10027493 [exp]	0	1
AT4G31870		ATGPX7	glutathione peroxidase 7 (.1)		Lus10026887 [exp]	2.2	0.9204
AT4G09350		NdhT, CRRJ	NADH dehydrogenase-like comple...		Lus10042771 [exp]	7.5	0.9088
AT3G52520			unknown protein		Lus10029420 [exp]	7.5	0.8918
AT1G79510			Uncharacterized conserved prot...		Lus10009597 [exp]	9.2	0.9084
AT4G09350		NdhT, CRRJ	NADH dehydrogenase-like comple...		Lus10029740 [exp]	9.6	0.9085
AT1G68660			Ribosomal protein L12/ ATP-dep...		Lus10041479 [exp]	9.8	0.8866
AT2G15020			unknown protein		Lus10013880 [exp]	10.5	0.9049
AT1G22430			GroES-like zinc-binding dehydr...		Lus10004786 [exp]	13.9	0.8943
AT1G68660			Ribosomal protein L12/ ATP-dep...		Lus10034292 [exp]	15.0	0.8751
AT2G36800		UGT73C5, DOGT1	UDP-GLUCOSYL TRANSFERASE 73C5,...		Lus10003323 [exp]	16.2	0.8827

Compare expression of checked genes

Lus10027493 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.