Lus10027510 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25680 337 / 8e-118 PPPDE putative thiol peptidase family protein (.1)
AT4G25660 333 / 4e-116 PPPDE putative thiol peptidase family protein (.1)
AT2G25190 100 / 6e-25 PPPDE putative thiol peptidase family protein (.1)
AT5G25170 90 / 2e-21 PPPDE putative thiol peptidase family protein (.1)
AT1G47740 91 / 3e-21 PPPDE putative thiol peptidase family protein (.1.2)
AT5G47310 90 / 4e-21 PPPDE putative thiol peptidase family protein (.1)
AT1G80690 89 / 6e-21 PPPDE putative thiol peptidase family protein (.1)
AT4G17486 88 / 1e-20 PPPDE putative thiol peptidase family protein (.1.2)
AT4G31980 88 / 1e-19 unknown protein
AT3G07090 59 / 5e-10 PPPDE putative thiol peptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039275 523 / 0 AT4G25680 348 / 6e-122 PPPDE putative thiol peptidase family protein (.1)
Lus10038841 400 / 7e-143 AT4G25680 343 / 2e-120 PPPDE putative thiol peptidase family protein (.1)
Lus10014960 398 / 8e-142 AT4G25680 341 / 1e-119 PPPDE putative thiol peptidase family protein (.1)
Lus10007844 100 / 2e-25 AT4G17486 277 / 3e-95 PPPDE putative thiol peptidase family protein (.1.2)
Lus10004755 100 / 3e-25 AT4G17486 273 / 2e-93 PPPDE putative thiol peptidase family protein (.1.2)
Lus10017127 98 / 1e-24 AT5G25170 312 / 3e-109 PPPDE putative thiol peptidase family protein (.1)
Lus10018326 98 / 1e-24 AT5G25170 314 / 3e-110 PPPDE putative thiol peptidase family protein (.1)
Lus10040170 97 / 3e-24 AT4G17486 283 / 9e-98 PPPDE putative thiol peptidase family protein (.1.2)
Lus10004372 97 / 1e-22 AT5G47310 244 / 1e-77 PPPDE putative thiol peptidase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G143132 384 / 4e-136 AT4G25680 331 / 2e-115 PPPDE putative thiol peptidase family protein (.1)
Potri.004G079800 382 / 3e-135 AT4G25680 339 / 1e-118 PPPDE putative thiol peptidase family protein (.1)
Potri.003G080300 99 / 9e-25 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
Potri.018G021700 98 / 2e-24 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
Potri.006G261500 97 / 3e-24 AT5G25170 313 / 5e-109 PPPDE putative thiol peptidase family protein (.1)
Potri.001G154400 96 / 2e-23 AT5G47310 308 / 4e-107 PPPDE putative thiol peptidase family protein (.1)
Potri.001G047800 90 / 2e-21 AT1G80690 298 / 2e-103 PPPDE putative thiol peptidase family protein (.1)
Potri.003G180400 87 / 2e-20 AT1G80690 303 / 1e-105 PPPDE putative thiol peptidase family protein (.1)
Potri.T126004 85 / 2e-19 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.009G113168 85 / 2e-19 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF05903 Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence
>Lus10027510 pacid=23144548 polypeptide=Lus10027510 locus=Lus10027510.g ID=Lus10027510.BGIv1.0 annot-version=v1.0
ATGACGGAAGTGATATTGCACATATACGATGTGACCAACAGTGGATCGGAGAAGACGAACACGACGATCATGCAGATCAACAAGATCTTCAAGGACGGTA
TCGGCCTCGGCGGCATCTTCCACAGTGCTATTCAGGTTTATGGAGAAGATGAATGGTCGTTTGGCTTTTGCGAAACTGGAACCGGGGTGTTCAATTGCCC
TTCCGGAAAGAATCCAATGTATACATACCGTGAAAGCATTGTGCTTGGGAAAACCAACTTTTCACGAATGAAAGTGAATCAGATCCTACGAGAACTTAGT
TGGGAATGGCCTGGAAATTGTTATGATCTGTTGGCCAAGAACTGTAATCACTTCTGTGATGAGCTCTGTGAAAAGCTAGGCGTCCCGAAACTTCCAGGCT
GGGTTAACCGATTTGCCAATGCCGGTGATGCTGCTGTTGAAATAGCTGGAAACACAGCCATACGATTTAGACAGGCTAAAACGGAGATTGTCTCAGCAAG
TAAAGTAGCCTACCGTTTCCTACTGGGTGTTACCTCCAACAACGGTTCAACAGTTGAATCCCCTGGAAACTCCAACGGAGGAGGTTCCCCTAGGATGCAA
TCAACTTGGTTCAAGAATCTCGTTACCAACGGGGCAAAACCTTCTACCAGTACAGAAGTCGACTCGCTGCAGGTTGATTCGGTTTCCACGCCGCCACAAA
TTCAGCAAGTTTCACGGCAGGAAGATTCGGAGGTATCACACCAGCAGAATGGACAGGGAGAGGACTCGCACGGTCTGCTGAGACACAACTCGAGGCACTA
CGACTGA
AA sequence
>Lus10027510 pacid=23144548 polypeptide=Lus10027510 locus=Lus10027510.g ID=Lus10027510.BGIv1.0 annot-version=v1.0
MTEVILHIYDVTNSGSEKTNTTIMQINKIFKDGIGLGGIFHSAIQVYGEDEWSFGFCETGTGVFNCPSGKNPMYTYRESIVLGKTNFSRMKVNQILRELS
WEWPGNCYDLLAKNCNHFCDELCEKLGVPKLPGWVNRFANAGDAAVEIAGNTAIRFRQAKTEIVSASKVAYRFLLGVTSNNGSTVESPGNSNGGGSPRMQ
STWFKNLVTNGAKPSTSTEVDSLQVDSVSTPPQIQQVSRQEDSEVSHQQNGQGEDSHGLLRHNSRHYD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G25680 PPPDE putative thiol peptidase... Lus10027510 0 1
AT1G18650 PDCB3 plasmodesmata callose-binding ... Lus10037071 1.0 0.8984
AT2G27260 Late embryogenesis abundant (L... Lus10043411 10.2 0.8484
AT1G54990 RGR1, AXR4 REDUCED ROOT GRAVITROPISM 1, R... Lus10029924 11.1 0.8664
AT4G29870 Oligosaccharyltransferase comp... Lus10035623 11.7 0.8750
AT1G29330 ATERD2, AERD2, ... ARABIDOPSIS THALIANA ENDOPLASM... Lus10007314 12.5 0.7632
AT2G18840 Integral membrane Yip1 family ... Lus10006966 16.2 0.8516
AT4G36020 CSDP1 cold shock domain protein 1 (.... Lus10041902 17.7 0.8423
AT1G29970 RPL18AA 60S ribosomal protein L18A-1 (... Lus10013704 19.0 0.7263
AT5G16510 RGP5 reversibly glycosylated protei... Lus10020379 20.0 0.8504
AT1G19480 DNA glycosylase superfamily pr... Lus10010824 21.9 0.8510

Lus10027510 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.