Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G52552 76 / 1e-20 CPuORF14 conserved peptide upstream open reading frame 14 (.1) AT4G25672 76 / 1e-20 CPuORF12 conserved peptide upstream open reading frame 12 (.1) AT4G25692 56 / 1e-12 CPuORF13 conserved peptide upstream open reading frame 13 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038842 [exp] 72 / 3e-17 AT4G25670 149 / 3e-45 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G080000 [exp] 91 / 1e-26 AT5G52552 83 / 2e-23 conserved peptide upstream open reading frame 14 (.1) Potri.017G143300 [exp] 87 / 5e-25 AT5G52552 82 / 3e-23 conserved peptide upstream open reading frame 14 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027512 pacid=23144534 polypeptide=Lus10027512 locus=Lus10027512.g ID=Lus10027512.BGIv1.0 annot-version=v1.0 ATGGGCAGTTGCAAGGGTTGTGGGAAATTGGGGAGAATGGCACAAAGGGATCAATCGGTTAGCGGCTACCATTTCGTGATTATGCTGTCTCCGATAATTT CTTTCTGGGATTGCATCGTGCGGAAGATGAGATACTCCCACAGACCTGAGTGGGTGTAG
AA sequence Show only first row Show all	>Lus10027512 pacid=23144534 polypeptide=Lus10027512 locus=Lus10027512.g ID=Lus10027512.BGIv1.0 annot-version=v1.0 MGSCKGCGKLGRMAQRDQSVSGYHFVIMLSPIISFWDCIVRKMRYSHRPEWV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G25672		CPuORF12	conserved peptide upstream ope...		Lus10027512 [exp]	0	1
AT3G03860		ATAPRL5	APR-like 5 (.1)		Lus10005703 [exp]	1.0	0.9202
AT4G30560		ATCNGC9	cyclic nucleotide gated channe...		Lus10022155 [exp]	3.0	0.8921
AT5G67580	MYB	ATTBP3, TRB2, A...	TELOMERE-BINDING PROTEIN 3, TE...		Lus10011546 [exp]	3.2	0.8935
AT3G59380		FTA, PLP, ATFTA...	PLURIPETALA, farnesyltransfera...		Lus10000763 [exp]	4.2	0.8721
AT3G51040		RTH	RTE1-homolog (.1.2.3)		Lus10041800 [exp]	4.5	0.8718
AT5G67580	MYB	ATTBP3, TRB2, A...	TELOMERE-BINDING PROTEIN 3, TE...		Lus10019260 [exp]	4.9	0.8832
AT3G17000		UBC32	ubiquitin-conjugating enzyme 3...		Lus10037759 [exp]	5.1	0.8692
AT3G20300			Protein of unknown function (D...		Lus10024308 [exp]	5.9	0.8777
AT3G17000		UBC32	ubiquitin-conjugating enzyme 3...		Lus10016898 [exp]	5.9	0.8832
AT1G22730			MA3 domain-containing protein ...		Lus10011324 [exp]	6.3	0.8725

Compare expression of checked genes

Lus10027512 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.