Lus10027514 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G22400 117 / 4e-32 ATUGT85A1, UGT85A1 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
AT1G22370 116 / 6e-32 ATUGT85A5 UDP-glucosyl transferase 85A5 (.1.2)
AT1G22360 115 / 1e-31 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 (.1.2)
AT1G22340 113 / 1e-30 ATUGT85A7 UDP-glucosyl transferase 85A7 (.1)
AT1G78270 111 / 7e-30 ATUGT85A4 UDP-glucosyl transferase 85A4 (.1)
AT1G22380 109 / 2e-29 ATUGT85A3 UDP-glucosyl transferase 85A3 (.1)
AT3G02100 57 / 1e-10 UDP-Glycosyltransferase superfamily protein (.1)
AT3G21560 54 / 1e-09 UGT84A2 UDP-Glycosyltransferase superfamily protein (.1)
AT3G46660 54 / 2e-09 UGT76E12 UDP-glucosyl transferase 76E12 (.1)
AT2G31750 53 / 3e-09 UGT74D1 UDP-glucosyl transferase 74D1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039277 175 / 7e-54 AT1G22400 499 / 3e-174 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10013923 143 / 7e-42 AT1G22400 537 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10013924 131 / 3e-37 AT1G22400 551 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10013922 129 / 1e-36 AT1G22400 533 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10000993 117 / 5e-32 AT1G22380 563 / 0.0 UDP-glucosyl transferase 85A3 (.1)
Lus10013925 116 / 1e-31 AT1G22380 560 / 0.0 UDP-glucosyl transferase 85A3 (.1)
Lus10024583 114 / 6e-31 AT1G22380 598 / 0.0 UDP-glucosyl transferase 85A3 (.1)
Lus10032220 112 / 2e-30 AT1G22380 601 / 0.0 UDP-glucosyl transferase 85A3 (.1)
Lus10024584 111 / 7e-30 AT1G22400 570 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G052166 117 / 4e-32 AT1G22360 607 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
Potri.001G312600 117 / 4e-32 AT1G22360 586 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
Potri.017G052300 116 / 6e-32 AT1G22360 603 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
Potri.005G073766 115 / 1e-31 AT1G22400 562 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Potri.005G073800 115 / 1e-31 AT1G22400 562 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Potri.002G098300 114 / 7e-31 AT1G22360 602 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
Potri.017G052000 112 / 3e-30 AT1G22360 617 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
Potri.017G052100 112 / 4e-30 AT1G22360 612 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
Potri.001G313000 110 / 1e-29 AT1G22360 564 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
Potri.017G052400 110 / 2e-29 AT1G22360 620 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
PFAM info
Representative CDS sequence
>Lus10027514 pacid=23144463 polypeptide=Lus10027514 locus=Lus10027514.g ID=Lus10027514.BGIv1.0 annot-version=v1.0
ATGAAACGGGTGGTCGTCGCCGCCAAACCCCAAAACAAGCCGGCGCCAGTGCCGAGGCCACACGCCGTCTGCGTTCCCCTTCCGTTTCAAGGACACATAA
ACCCGATGCTCCGAGTGGCGAAACTCCTCCACTCACGAAGCTTCCATATAACCTTCGTCAACACAGAGTCCAACCACAACCGCCTCCTCAAGTCATGGGG
AGGCAGCGCCACCGCCCTGCCGCCGGGATTCAACTTCGAGACCTTCCCTGCAGGGCTTCCGCTGTCTGACGACATGGACATAAGCCAGATGGTCCCGTTG
GTGTGCGAATCCATCCTAAACAACTGGTTGGCTCCGTTTTAA
AA sequence
>Lus10027514 pacid=23144463 polypeptide=Lus10027514 locus=Lus10027514.g ID=Lus10027514.BGIv1.0 annot-version=v1.0
MKRVVVAAKPQNKPAPVPRPHAVCVPLPFQGHINPMLRVAKLLHSRSFHITFVNTESNHNRLLKSWGGSATALPPGFNFETFPAGLPLSDDMDISQMVPL
VCESILNNWLAPF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G22400 ATUGT85A1, UGT8... ARABIDOPSIS THALIANA UDP-GLUCO... Lus10027514 0 1
Lus10010271 1.7 0.9389
AT3G07840 Pectin lyase-like superfamily ... Lus10011030 4.5 0.8698
AT1G14185 Glucose-methanol-choline (GMC)... Lus10030463 5.5 0.8468
AT3G28960 Transmembrane amino acid trans... Lus10023029 5.8 0.8779
Lus10012132 6.2 0.8737
AT2G37890 Mitochondrial substrate carrie... Lus10036193 6.9 0.8285
Lus10000890 10.1 0.8093
Lus10025017 12.6 0.7805
AT5G01250 alpha 1,4-glycosyltransferase ... Lus10035526 20.4 0.7812
AT5G51950 Glucose-methanol-choline (GMC)... Lus10015012 23.9 0.8426

Lus10027514 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.