Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25740 99 / 2e-27 RNA binding Plectin/S10 domain-containing protein (.1.2) AT5G52650 99 / 2e-27 RNA binding Plectin/S10 domain-containing protein (.1) AT5G41520 89 / 2e-23 RNA binding Plectin/S10 domain-containing protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039282 [exp] 127 / 3e-38 AT4G25740 236 / 1e-80 RNA binding Plectin/S10 domain-containing protein (.1.2) Lus10038846 [exp] 109 / 2e-29 AT5G52660 292 / 2e-96 Homeodomain-like superfamily protein (.1.2) Lus10032298 [exp] 110 / 4e-29 AT1G63910 260 / 2e-82 myb domain protein 103 (.1) Lus10024669 [exp] 110 / 4e-29 AT1G63910 260 / 2e-82 myb domain protein 103 (.1) Lus10014966 [exp] 79 / 2e-18 AT4G25740 216 / 5e-71 RNA binding Plectin/S10 domain-containing protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G146700 [exp] 109 / 2e-31 AT4G25740 180 / 1e-58 RNA binding Plectin/S10 domain-containing protein (.1.2) Potri.004G073500 [exp] 108 / 5e-31 AT4G25740 178 / 6e-58 RNA binding Plectin/S10 domain-containing protein (.1.2) Potri.013G027900 [exp] 108 / 7e-31 AT5G52650 179 / 8e-58 RNA binding Plectin/S10 domain-containing protein (.1) Potri.005G040100 [exp] 107 / 1e-30 AT4G25740 177 / 2e-57 RNA binding Plectin/S10 domain-containing protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [flax] [poplar] HTH PF03501 [flax] [poplar] S10_plectin Plectin/S10 domain
Representative CDS sequence Show only first row Show all	>Lus10027519 pacid=23144567 polypeptide=Lus10027519 locus=Lus10027519.g ID=Lus10027519.BGIv1.0 annot-version=v1.0 ATGATTATCTCAGAGAAGAACAGGAGAGAAATCTCGAAGTACCTCTTCCAAGAGGGAGTGTGTTATGCTAAGAAGGATTTCAACCTTGCAAAGCACCCAG ACATCGATGTCCCCAACCTTCAGGTGATTAAGCTGATGCAGAGCTTCAAATCCAAGGAGGGGCCTCCTGGTGACCGTCCAAGGTTTGGTGACCGTGATGG TTACCGTAGTGGTCCTCGTGAGGGAGGTTTTGGTGGTGGAAAGGAAGGTGCTCCAGCTGACTTCCAGCCATCCTTCAGGGGTTCTGGAAGGGGTATGGGA CGTGGAGGCTATACCGGTGGTGCTCCAGCTCCAAGCAGCTCTGGATATGCTGAATGA
AA sequence Show only first row Show all	>Lus10027519 pacid=23144567 polypeptide=Lus10027519 locus=Lus10027519.g ID=Lus10027519.BGIv1.0 annot-version=v1.0 MIISEKNRREISKYLFQEGVCYAKKDFNLAKHPDIDVPNLQVIKLMQSFKSKEGPPGDRPRFGDRDGYRSGPREGGFGGGKEGAPADFQPSFRGSGRGMG RGGYTGGAPAPSSSGYAE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G25740			RNA binding Plectin/S10 domain...		Lus10027519 [exp]	0	1
AT3G02080			Ribosomal protein S19e family ...		Lus10000095 [exp]	2.0	0.8856
AT1G36240			Ribosomal protein L7Ae/L30e/S1...		Lus10019682 [exp]	2.2	0.9169
AT3G13570		SCL30A, At-SCL3...	SC35-like splicing factor 30A ...		Lus10012932 [exp]	3.6	0.8477
AT3G13580			Ribosomal protein L30/L7 famil...		Lus10021296 [exp]	4.6	0.8782
AT1G80560		ATIMD2	ARABIDOPSIS ISOPROPYLMALATE DE...		Lus10030344 [exp]	6.5	0.8683
AT2G47580		U1A	spliceosomal protein U1A (.1)		Lus10008424 [exp]	14.5	0.8541
AT3G02080			Ribosomal protein S19e family ...		Lus10010339 [exp]	15.0	0.8612
AT2G37270		ATRPS5B	ribosomal protein 5B (.1.2)		Lus10013381 [exp]	25.1	0.8406
AT1G07210			Ribosomal protein S18 (.1)		Lus10038756 [exp]	25.3	0.8224
AT4G16720			Ribosomal protein L23/L15e fam...		Lus10028965 [exp]	27.1	0.8696

Compare expression of checked genes

Lus10027519 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.