Lus10027522 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G01490 82 / 1e-20 Heavy metal transport/detoxification superfamily protein (.1.2)
AT5G52740 51 / 5e-09 Copper transport protein family (.1)
AT5G52760 49 / 3e-08 Copper transport protein family (.1)
AT5G52730 49 / 1e-07 Copper transport protein family (.1)
AT5G52770 42 / 7e-06 Copper transport protein family (.1)
AT5G23760 42 / 7e-06 Copper transport protein family (.1)
AT5G52750 43 / 9e-06 Heavy metal transport/detoxification superfamily protein (.1)
AT5G26690 37 / 0.0008 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039285 130 / 1e-39 AT1G01490 74 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10027523 127 / 2e-38 AT1G01490 77 / 3e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10027524 130 / 2e-37 AT1G01490 100 / 2e-25 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10039286 122 / 5e-35 AT1G01490 97 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10014967 92 / 5e-24 AT1G01490 100 / 9e-27 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10036395 82 / 2e-20 AT1G01490 131 / 1e-38 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10007911 81 / 2e-19 AT1G01490 128 / 2e-37 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10028762 65 / 4e-14 AT1G01490 74 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10007455 66 / 3e-13 AT3G44480 98 / 1e-20 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G099500 89 / 2e-23 AT1G01490 105 / 2e-29 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.003G132200 85 / 6e-22 AT1G01490 102 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.002G163400 85 / 9e-22 AT1G01490 110 / 3e-31 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.004G073000 81 / 3e-20 AT1G01490 96 / 5e-26 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.014G089700 80 / 2e-19 AT1G01490 115 / 9e-33 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.004G073100 79 / 2e-19 AT1G01490 82 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147500 78 / 2e-19 AT1G01490 91 / 4e-24 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147400 71 / 2e-16 AT1G01490 74 / 2e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147200 59 / 5e-12 AT1G01490 64 / 1e-13 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147000 59 / 9e-12 AT1G01490 61 / 2e-12 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00403 HMA Heavy-metal-associated domain
Representative CDS sequence
>Lus10027522 pacid=23144581 polypeptide=Lus10027522 locus=Lus10027522.g ID=Lus10027522.BGIv1.0 annot-version=v1.0
ATGAAGCAAGTGGTGCTTACGCTGGATCTACCCGACGACCGAGACAAGCGGAGAGCACTGAAGCGAGTAACGGCCACGACCTCCGGCATTGACTCGATTT
CCGTGGACATGAAGGAGAAGAAGCTGACGGTGACCGGGGACTTTGACCCTGTCAAAGTAGTGAGCAAGCTGAGGAAGTTTTATCGCACGGACGTAGTCTC
CGTCGGGGAGCCGAAGAAGCCGGAGGATAACAAGAAGAAGGGAGCGGCGGGGGAGGATGGGGGAAAAGACAAGAAGGACCCTGAACCGATGGTAGCAGTA
CCGTACTGTGGCTGCTATCCTCACCACAACAGCTACAACTCGTACGGACGCTATGGTCAAGTAGTTGCGGGGGATGACCCTAATAATATTGTTTGTGTTA
TTTCTTAA
AA sequence
>Lus10027522 pacid=23144581 polypeptide=Lus10027522 locus=Lus10027522.g ID=Lus10027522.BGIv1.0 annot-version=v1.0
MKQVVLTLDLPDDRDKRRALKRVTATTSGIDSISVDMKEKKLTVTGDFDPVKVVSKLRKFYRTDVVSVGEPKKPEDNKKKGAAGEDGGKDKKDPEPMVAV
PYCGCYPHHNSYNSYGRYGQVVAGDDPNNIVCVIS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G01490 Heavy metal transport/detoxifi... Lus10027522 0 1
Lus10041663 1.7 0.9053
AT3G57120 Protein kinase superfamily pro... Lus10029721 2.4 0.9080
Lus10017954 3.0 0.9255
AT3G57120 Protein kinase superfamily pro... Lus10011518 3.2 0.8995
Lus10012064 3.5 0.8743
Lus10023082 4.0 0.8688
AT2G14610 PR-1, PR1, ATPR... pathogenesis-related gene 1 (.... Lus10020491 4.2 0.8938
AT1G34670 MYB ATMYB93 myb domain protein 93 (.1) Lus10039771 6.0 0.8858
Lus10019165 6.0 0.9026
AT1G69260 AFP1 ABI five binding protein (.1) Lus10036898 7.7 0.8696

Lus10027522 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.