Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01490 86 / 5e-22 Heavy metal transport/detoxification superfamily protein (.1.2) AT5G52740 67 / 2e-15 Copper transport protein family (.1) AT5G52760 62 / 2e-13 Copper transport protein family (.1) AT5G52750 57 / 3e-11 Heavy metal transport/detoxification superfamily protein (.1) AT5G52730 54 / 1e-09 Copper transport protein family (.1) AT5G52770 49 / 4e-08 Copper transport protein family (.1) AT5G23760 44 / 2e-06 Copper transport protein family (.1) AT5G26690 44 / 3e-06 Heavy metal transport/detoxification superfamily protein (.1) AT3G05920 43 / 5e-06 Heavy metal transport/detoxification superfamily protein (.1) AT1G63950 42 / 7e-06 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039286 [exp] 140 / 8e-42 AT1G01490 97 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10027524 [exp] 133 / 1e-38 AT1G01490 100 / 2e-25 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10027522 [exp] 104 / 1e-29 AT1G01490 83 / 7e-21 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10039285 [exp] 100 / 4e-28 AT1G01490 74 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10014967 [exp] 90 / 2e-23 AT1G01490 100 / 9e-27 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10036395 [exp] 87 / 3e-22 AT1G01490 131 / 1e-38 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10007911 [exp] 86 / 1e-21 AT1G01490 128 / 2e-37 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10007455 [exp] 70 / 7e-15 AT3G44480 98 / 1e-20 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10028762 [exp] 65 / 5e-14 AT1G01490 74 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G099500 [exp] 100 / 3e-28 AT1G01490 105 / 2e-29 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.003G132200 [exp] 95 / 6e-26 AT1G01490 102 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.004G073000 [exp] 94 / 2e-25 AT1G01490 96 / 5e-26 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G147500 [exp] 92 / 1e-24 AT1G01490 91 / 4e-24 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.004G073100 [exp] 87 / 4e-23 AT1G01490 82 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.002G163400 [exp] 88 / 6e-23 AT1G01490 110 / 3e-31 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G147400 [exp] 82 / 6e-21 AT1G01490 74 / 2e-17 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.014G089700 [exp] 83 / 8e-21 AT1G01490 115 / 9e-33 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G147200 [exp] 73 / 2e-17 AT1G01490 64 / 1e-13 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G147000 [exp] 73 / 3e-17 AT1G01490 61 / 2e-12 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10027523 pacid=23144499 polypeptide=Lus10027523 locus=Lus10027523.g ID=Lus10027523.BGIv1.0 annot-version=v1.0 ATGAAGCAAGTGGTACTGAAACTGGATCTACACGGCGACCGAGACAAGCAGAGAGCTCTGAAGAAAGTCACGGGGATCTCCGGCGTTGACTCTTTCTCCA TGGACATGAAGGAGAAGAAGCTCACGGTCACCGGAGACTTTGACCCGGTCAAAGTTGTGAGCAAGCTGAGGAAGATATGTCACACTGACATAGTCTCCGT CGGAGAGCCCAAGAAGAAGGAAGATCCGGCGGCGGCGAAGAAGCCGGCGGAGGATGGAGGAAAAGACAAAAAGAACCCTGAACCGGTGGTGGTACCGTAC TACTACCATCCGAACAGTTATTGCCGTAATTACAATTACGAACGCCATGGTCAAGTAGCTGGCGATGACCCTAATTCCTGTGTCATTTGTTAA
AA sequence Show only first row Show all	>Lus10027523 pacid=23144499 polypeptide=Lus10027523 locus=Lus10027523.g ID=Lus10027523.BGIv1.0 annot-version=v1.0 MKQVVLKLDLHGDRDKQRALKKVTGISGVDSFSMDMKEKKLTVTGDFDPVKVVSKLRKICHTDIVSVGEPKKKEDPAAAKKPAEDGGKDKKNPEPVVVPY YYHPNSYCRNYNYERHGQVAGDDPNSCVIC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G01490			Heavy metal transport/detoxifi...		Lus10027523 [exp]	0	1
AT2G41480			Peroxidase superfamily protein...		Lus10020422 [exp]	1.0	0.9554
AT2G01770		ATVIT1, VIT1	vacuolar iron transporter 1 (....		Lus10001589 [exp]	2.8	0.9239
AT2G15490		UGT73B4	UDP-glycosyltransferase 73B4 (...		Lus10014086 [exp]	3.0	0.9338
AT3G53820	C2H2ZnF		C2H2 and C2HC zinc fingers sup...		Lus10024363 [exp]	3.2	0.9389
					Lus10029825 [exp]	7.7	0.9051
AT1G08510		FATB	fatty acyl-ACP thioesterases B...		Lus10000365 [exp]	7.9	0.8926
AT4G29700			Alkaline-phosphatase-like fami...		Lus10000041 [exp]	12.6	0.9325
AT3G59310			Eukaryotic protein of unknown ...		Lus10003247 [exp]	14.5	0.9165
					Lus10029451 [exp]	16.9	0.8848
AT4G30230			unknown protein		Lus10041416 [exp]	17.3	0.9062

Compare expression of checked genes

Lus10027523 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.