Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039288 [exp] 149 / 2e-44 AT5G52790 449 / 1e-154 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10027528 [exp] 61 / 6e-12 AT5G52790 560 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G147900 [exp] 43 / 1e-05 AT5G52790 580 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027526 pacid=23144573 polypeptide=Lus10027526 locus=Lus10027526.g ID=Lus10027526.BGIv1.0 annot-version=v1.0 ATGCTGTCATCTGAAAGATCGCCGACGGCATCACCTGGTGGAACTGCGTCAGGTTCTCAGTTTCAACGACGGCACTCTCCTGTACCGTACCAGATGCAGA GTCCGGTGATGCCGCTGATTGTGCCGTACATTGTTCGGTCACCGTTAATGAGAATTCCTCTGTCAGTTTCTCCGGCAAAGTCTCACCCGAATTCTCCAGC TGCGATCGTTGCCCACAGTCCTGATCAGGGTCTTTCCCTTTCATCGCACCGGGTTTCCAGGAAACCGTACAAGAAGCTGAGGAAACCTGGACCTGTAACA TTTTACCCCTGTGTGTTCGCTTCTGTTAGTTAG
AA sequence Show only first row Show all	>Lus10027526 pacid=23144573 polypeptide=Lus10027526 locus=Lus10027526.g ID=Lus10027526.BGIv1.0 annot-version=v1.0 MLSSERSPTASPGGTASGSQFQRRHSPVPYQMQSPVMPLIVPYIVRSPLMRIPLSVSPAKSHPNSPAAIVAHSPDQGLSLSSHRVSRKPYKKLRKPGPVT FYPCVFASVS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10027526 [exp]	0	1
AT1G72490			unknown protein		Lus10013160 [exp]	2.8	0.7642
AT3G18170			Glycosyltransferase family 61 ...		Lus10032454 [exp]	7.1	0.7592
AT5G02910			F-box/RNI-like superfamily pro...		Lus10000727 [exp]	8.7	0.7592
AT3G08030			Protein of unknown function, D...		Lus10029502 [exp]	10.0	0.7592
AT2G24370			Protein kinase protein with ad...		Lus10027593 [exp]	11.2	0.7592
					Lus10004437 [exp]	12.2	0.7592
					Lus10021739 [exp]	13.2	0.7592
					Lus10039674 [exp]	14.1	0.7592
AT2G26490			Transducin/WD40 repeat-like su...		Lus10032868 [exp]	15.0	0.7592
AT1G30700			FAD-binding Berberine family p...		Lus10031080 [exp]	15.8	0.7592

Compare expression of checked genes

Lus10027526 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.