Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G21190 56 / 6e-10 EMB1417 embryo defective 1417, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039292 [exp] 140 / 3e-41 AT4G21190 339 / 7e-116 embryo defective 1417, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G148700 [exp] 71 / 2e-15 AT4G21190 339 / 3e-116 embryo defective 1417, Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027533 pacid=23144594 polypeptide=Lus10027533 locus=Lus10027533.g ID=Lus10027533.BGIv1.0 annot-version=v1.0 ATGCTTTCATTACGGTACTGTGTGCCGCTTATCCCGAAGAGAGTGCAATCGATTCGAGCCCCAAAGAGTCCGAGGAGTTTTATTGTGAGTTTTCTATTCT CCTTCAGCTTCAATGCTAGCAAAGTTTTTAACTGGGTGGTGAATGATTTGATTCAGGTATGTGAGCAGAAAGGGCCACGGCAAAGATATCCTCGAGTTTG GAAAACCAAGACAAAGATTGGAACCATCTCCAAGGCAGCTAAGCTTGTCGATTGTTCTAGCTGGTTCGATCTCAGGTACAATTTGTGGTTTTGGGTCAAT GCTATTAAACTTGCAAGTCCTAGAAGAGGTACTTATCCATCCATTACGCTGAAAAGAGTGTTTGGAATGTGGATGACAAGAGAATGA
AA sequence Show only first row Show all	>Lus10027533 pacid=23144594 polypeptide=Lus10027533 locus=Lus10027533.g ID=Lus10027533.BGIv1.0 annot-version=v1.0 MLSLRYCVPLIPKRVQSIRAPKSPRSFIVSFLFSFSFNASKVFNWVVNDLIQVCEQKGPRQRYPRVWKTKTKIGTISKAAKLVDCSSWFDLRYNLWFWVN AIKLASPRRGTYPSITLKRVFGMWMTRE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G21190		EMB1417	embryo defective 1417, Pentatr...		Lus10027533 [exp]	0	1
AT4G02260		AT-RSH1, RSH1, ...	RELA-SPOT HOMOLOG 1, RELA/SPOT...		Lus10003599 [exp]	2.8	0.9123
AT1G76050			Pseudouridine synthase family ...		Lus10017250 [exp]	5.5	0.8987
AT3G63370		OTP86	ORGANELLE TRANSCRIPT PROCESSIN...		Lus10014707 [exp]	8.2	0.8811
AT4G03090			sequence-specific DNA binding;...		Lus10006938 [exp]	8.4	0.9151
AT1G73970			unknown protein		Lus10000648 [exp]	11.8	0.8845
AT3G16000		MFP1	MAR binding filament-like prot...		Lus10025769 [exp]	16.1	0.8825
AT1G17450			B-block binding subunit of TFI...		Lus10037675 [exp]	17.5	0.8810
AT1G22060			unknown protein		Lus10033461 [exp]	18.7	0.8876
AT3G20540		PolIB, POLGAMMA...	polymerase I B, polymerase gam...		Lus10019619 [exp]	19.1	0.8926
AT5G50840			unknown protein		Lus10023501 [exp]	20.4	0.8462

Compare expression of checked genes

Lus10027533 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.