Plant FIBer expression Database

Lus10027535 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G21190 267 / 3e-89 EMB1417 embryo defective 1417, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G18975 139 / 5e-40 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2), Pentatricopeptide repeat (PPR) superfamily protein (.3), Pentatricopeptide repeat (PPR) superfamily protein (.4)
AT1G04590 114 / 4e-29 EMB2748 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039292
[exp]
384 / 5e-134 AT4G21190 339 / 7e-116 embryo defective 1417, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10028526
[exp]
120 / 3e-32 AT4G18975 327 / 7e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2), Pentatricopeptide repeat (PPR) superfamily protein (.3), Pentatricopeptide repeat (PPR) superfamily protein (.4)
Lus10019008
[exp]
110 / 3e-28 AT1G04590 281 / 5e-93 unknown protein
Lus10015943
[exp]
108 / 3e-28 AT1G04590 284 / 3e-95 unknown protein
Lus10009120
[exp]
74 / 8e-15 AT4G18975 198 / 1e-61 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2), Pentatricopeptide repeat (PPR) superfamily protein (.3), Pentatricopeptide repeat (PPR) superfamily protein (.4)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G148700
[exp]
253 / 5e-83 AT4G21190 339 / 3e-116 embryo defective 1417, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.011G076800
[exp]
140 / 3e-40 AT4G18975 320 / 2e-110 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2), Pentatricopeptide repeat (PPR) superfamily protein (.3), Pentatricopeptide repeat (PPR) superfamily protein (.4)
Potri.016G103000
[exp]
119 / 1e-31 AT1G04590 300 / 9e-101 unknown protein
Potri.006G091500
[exp]
113 / 6e-30 AT1G04590 272 / 3e-90 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10027535 pacid=23144555 polypeptide=Lus10027535 locus=Lus10027535.g ID=Lus10027535.BGIv1.0 annot-version=v1.0
ATGCTAAAGATAAAGGGATTGTCAAATGTGAAGGAGGAAGTGTATGGAGCTCTTGATTCCTTTGTTGCTTGGGACTTGGAGTTCCCACTAATTACTGTGA
AGAAAGCGTTGAGGAGTCTTGAATTTCAGCAAGAATGGAAGAGGATAATTCAGGTGTCTAAGTGGATGCTAAACAAAGGGCAAGGAAGGACAATGGGGAC
TTATTTCACCTTGCTGAATGCATTAGCAGAGGATGAAAGGCTCGAGGAAGCTGAGGAGCTTTGGAACAAGCTGTTCATGAAATACCTGGAAGGCATGCCT
CGTAAGTTCTTCGATAAGATGATGTCCATCTACTACAAGAAGGATATGCATGACAAGATGTTTGAGATATTTGCTGACATGGAGGAACTAGGCGTTCAGC
CGAGTGCTTCAATCGTCAGCATGGTGGGGAGTGTATTCCAGCACCGAGGCATGCTGGACAAGTACGAGAAACTGAAGAGTAAGTACCCTCCGCCGAAATA
TGAGATCAAATACATAAAAGGGAAGCGTGTGAAGATTAGAGCGAAGCAGTACCGCGAGTATGATCGTGAATGGAGAGGTGAAGGCGAGGGGTACACAAGC
TCAGACGAAATAGATGAAGAGAGAGGTGCAAATATGGACGATGATGGCAATTGTGATGTGCTGGACGAAAACAACGATGAGGAAGATGTCGAAAACCAGG
CTCCTGCAATGATCTCAAATGAAGTGGACAAAACAGGTACTTATGGCGATGACCTGACTGATAGTTTAAGCAGTAGCGACGAGATTGGATTTGTCTCAAT
GAAGTTTGATGTCAATAGAGGACAGTAG
AA sequence
>Lus10027535 pacid=23144555 polypeptide=Lus10027535 locus=Lus10027535.g ID=Lus10027535.BGIv1.0 annot-version=v1.0
MLKIKGLSNVKEEVYGALDSFVAWDLEFPLITVKKALRSLEFQQEWKRIIQVSKWMLNKGQGRTMGTYFTLLNALAEDERLEEAEELWNKLFMKYLEGMP
RKFFDKMMSIYYKKDMHDKMFEIFADMEELGVQPSASIVSMVGSVFQHRGMLDKYEKLKSKYPPPKYEIKYIKGKRVKIRAKQYREYDREWRGEGEGYTS
SDEIDEERGANMDDDGNCDVLDENNDEEDVENQAPAMISNEVDKTGTYGDDLTDSLSSSDEIGFVSMKFDVNRGQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G21190 EMB1417 embryo defective 1417, Pentatr... Lus10027535
[exp]
0 1
AT4G21190 EMB1417 embryo defective 1417, Pentatr... Lus10039292
[exp]
1.4 0.9029
AT2G17695 unknown protein Lus10028386
[exp]
1.4 0.9082
AT4G18370 DEGP5, DEG5, HH... PROTEASE HHOA PRECUSOR, DEGP p... Lus10028120
[exp]
3.6 0.8498
AT1G53120 RNA-binding S4 domain-containi... Lus10041931
[exp]
4.5 0.8535
AT3G26880 Plant self-incompatibility pro... Lus10025937
[exp]
4.5 0.8788
AT1G32070 ATNSI nuclear shuttle interacting (.... Lus10035604
[exp]
4.5 0.8840
AT1G13270 MAP1B, MAP1C methionine aminopeptidase 1B (... Lus10021701
[exp]
5.7 0.8912
AT3G07740 HXA2, HXA02, HA... homolog of yeast ADA2 2A (.1.2... Lus10000540
[exp]
6.9 0.8522
AT5G60335 Thioesterase superfamily prote... Lus10028483
[exp]
10.2 0.8477
AT5G25800 Polynucleotidyl transferase, r... Lus10028637
[exp]
11.2 0.8494

Lus10027535 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.