Lus10027550 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G52882 199 / 6e-60 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT4G28000 189 / 4e-56 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT1G64110 184 / 2e-54 DAA1 DUO1-activated ATPase 1, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
AT4G24860 78 / 8e-17 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT1G62130 68 / 2e-13 AAA-type ATPase family protein (.1)
AT4G02480 68 / 2e-13 AAA-type ATPase family protein (.1)
AT1G02890 67 / 3e-13 AAA-type ATPase family protein (.1.2)
AT1G50140 48 / 2e-06 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
AT3G19740 45 / 1e-05 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027551 281 / 2e-90 AT5G52882 1136 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10039309 280 / 1e-89 AT5G52882 1140 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10024692 175 / 6e-51 AT1G64110 1176 / 0.0 DUO1-activated ATPase 1, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Lus10017535 171 / 1e-49 AT1G64110 1157 / 0.0 DUO1-activated ATPase 1, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Lus10028752 169 / 1e-48 AT1G64110 1165 / 0.0 DUO1-activated ATPase 1, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Lus10005736 156 / 9e-46 AT4G28000 148 / 2e-54 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10036347 61 / 9e-11 AT4G02480 1395 / 0.0 AAA-type ATPase family protein (.1)
Lus10010282 61 / 1e-10 AT4G02480 1408 / 0.0 AAA-type ATPase family protein (.1)
Lus10017405 55 / 6e-09 AT3G19740 1223 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G026900 208 / 4e-63 AT5G52882 1146 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.012G035400 207 / 2e-62 AT5G52882 1137 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.001G097600 178 / 4e-52 AT1G64110 1159 / 0.0 DUO1-activated ATPase 1, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Potri.003G133700 172 / 7e-50 AT1G64110 1145 / 0.0 DUO1-activated ATPase 1, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Potri.015G094100 90 / 6e-21 AT4G02480 1128 / 0.0 AAA-type ATPase family protein (.1)
Potri.012G096300 89 / 2e-20 AT4G02480 1153 / 0.0 AAA-type ATPase family protein (.1)
Potri.014G131000 66 / 1e-12 AT1G02890 1432 / 0.0 AAA-type ATPase family protein (.1.2)
Potri.002G205900 64 / 5e-12 AT1G02890 1445 / 0.0 AAA-type ATPase family protein (.1.2)
Potri.007G069800 50 / 2e-07 AT1G50140 1215 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.005G093300 50 / 4e-07 AT3G19740 1209 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10027550 pacid=23144577 polypeptide=Lus10027550 locus=Lus10027550.g ID=Lus10027550.BGIv1.0 annot-version=v1.0
ATGGAGAACAAAAGAGCGCTTCTTTCTGCCTTGAGCGTGGGGGTTGGAGTTGGGGTTGGGTTGGGATTGGCATCATCTGGGCAAAACATTAGCAGATGGG
CAGTTGGAAATGGCTGCCCAGATGGTGTCTCAGCTGAACAGATTGAGCATGAGTTGATGAGACAGGTCATTGATGGCAGAGACACCAAAATCACCTTTGA
TGATTTCCCTTATTTCCTCTGCGAGAGGACTAGAATTTTGTTAATAAGTTCAGCCTATGTCCATCTAAAGGATTATGACTTCTCAAAGCACACCCGCAAT
CTTTCACCTGCCAGCAGGACTATCTTGCTCTCCGGACCTTTTGAACTGTATCAGCAAATGCTTGCCAGAGCTTTAGCACATCACTTTGACTCTAAGATTC
TGTTGTTGGATGCTACTGATTTTTCCGTCAAGTTGCAAAGCAAATATGGTTGCACTAAAAAGGAACCGTCTCTAAAGAAGTCTCTATCAGAGTTGGCATT
GGAAGGAATGTCTGGTTTGCTTGGCTCTTTTGCCATGCTTCTGGCTTGTGTCGAGCTCGAGCTTGTTTGA
AA sequence
>Lus10027550 pacid=23144577 polypeptide=Lus10027550 locus=Lus10027550.g ID=Lus10027550.BGIv1.0 annot-version=v1.0
MENKRALLSALSVGVGVGVGLGLASSGQNISRWAVGNGCPDGVSAEQIEHELMRQVIDGRDTKITFDDFPYFLCERTRILLISSAYVHLKDYDFSKHTRN
LSPASRTILLSGPFELYQQMLARALAHHFDSKILLLDATDFSVKLQSKYGCTKKEPSLKKSLSELALEGMSGLLGSFAMLLACVELELV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G52882 P-loop containing nucleoside t... Lus10027550 0 1
AT5G52882 P-loop containing nucleoside t... Lus10027551 1.0 0.8966
AT5G52882 P-loop containing nucleoside t... Lus10039309 2.8 0.8324
AT1G23880 NHL domain-containing protein ... Lus10039421 9.2 0.8292
AT4G12110 ATSMO1-1, SMO1-... sterol-4alpha-methyl oxidase 1... Lus10024555 10.8 0.8087
AT5G17910 unknown protein Lus10020367 11.1 0.8532
AT2G29620 unknown protein Lus10009543 12.7 0.8608
Lus10020368 14.0 0.8286
AT5G17910 unknown protein Lus10009544 14.1 0.8192
AT2G47500 P-loop nucleoside triphosphate... Lus10009851 15.3 0.8308
AT3G61130 GAUT1, LGT1 galacturonosyltransferase 1 (.... Lus10041389 15.9 0.8067

Lus10027550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.