Lus10027556 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G53830 164 / 9e-49 ATPME2 pectin methylesterase 2 (.1)
AT3G14310 162 / 1e-47 ATPME3 pectin methylesterase 3 (.1)
AT2G47670 62 / 2e-12 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62360 58 / 6e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G51520 55 / 8e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62770 54 / 1e-09 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G49180 54 / 5e-09 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT5G20740 53 / 5e-09 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25250 52 / 9e-09 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G02300 51 / 4e-08 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039314 268 / 8e-89 AT3G14310 702 / 0.0 pectin methylesterase 3 (.1)
Lus10037458 168 / 5e-51 AT3G14310 491 / 2e-170 pectin methylesterase 3 (.1)
Lus10003933 160 / 3e-47 AT3G14310 733 / 0.0 pectin methylesterase 3 (.1)
Lus10013344 119 / 4e-32 AT3G14310 698 / 0.0 pectin methylesterase 3 (.1)
Lus10001848 66 / 3e-14 AT3G14310 108 / 1e-27 pectin methylesterase 3 (.1)
Lus10038915 66 / 1e-13 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10001466 66 / 3e-13 AT4G02300 299 / 1e-105 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10029868 62 / 7e-12 AT3G05620 684 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10020677 61 / 2e-11 AT3G05620 681 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G072800 160 / 3e-47 AT3G14310 795 / 0.0 pectin methylesterase 3 (.1)
Potri.001G162400 150 / 1e-43 AT3G14310 792 / 0.0 pectin methylesterase 3 (.1)
Potri.018G051400 125 / 3e-34 AT3G14310 708 / 0.0 pectin methylesterase 3 (.1)
Potri.002G202500 78 / 2e-17 AT4G02320 576 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.006G256700 71 / 4e-15 AT3G14310 587 / 0.0 pectin methylesterase 3 (.1)
Potri.001G162500 69 / 2e-14 AT3G14310 541 / 0.0 pectin methylesterase 3 (.1)
Potri.001G162600 69 / 2e-14 AT3G14310 551 / 0.0 pectin methylesterase 3 (.1)
Potri.003G002800 67 / 1e-13 AT3G14310 592 / 0.0 pectin methylesterase 3 (.1)
Potri.003G002650 67 / 1e-13 AT3G14310 598 / 0.0 pectin methylesterase 3 (.1)
Potri.015G128700 63 / 6e-13 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10027556 pacid=23144612 polypeptide=Lus10027556 locus=Lus10027556.g ID=Lus10027556.BGIv1.0 annot-version=v1.0
ATGGACGTCATCAAGGCCTCCATTAATGTCACGTGCACCTCCGTCCGGCGTAACATTGCCGCCGTTAACAAAGCGCTGTCCACCAGGAAAGACCTTACCC
CAGGCTCCAGGTCAGCACTGAAAGACTGTGCGGAGACAATGAGCACGTCATTAGACGAGCTCCACGTAGCGCTAGCCGAGCTGGACGAATACCCAAACAA
GAAATCGATAACCCCACACGCCGAGGATCTAAAGACTTTACTAAGTGCAGCGATGACAAACCAGGAGACATGCCTTGACGGCTTCTCCCATGACGATTCC
GAGAAGAAGGTCAGGAAAACGCTGGAGACGGGGCCGGTCCGGGTCGAAAAGATGTGCGGTAATGCGCTGGGGATGATCGTCAACATGACGGAGACGGACA
TGGCTACTAACGCCGTAAAAAATTAG
AA sequence
>Lus10027556 pacid=23144612 polypeptide=Lus10027556 locus=Lus10027556.g ID=Lus10027556.BGIv1.0 annot-version=v1.0
MDVIKASINVTCTSVRRNIAAVNKALSTRKDLTPGSRSALKDCAETMSTSLDELHVALAELDEYPNKKSITPHAEDLKTLLSAAMTNQETCLDGFSHDDS
EKKVRKTLETGPVRVEKMCGNALGMIVNMTETDMATNAVKN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G53830 ATPME2 pectin methylesterase 2 (.1) Lus10027556 0 1
AT2G15220 Plant basic secretory protein ... Lus10026579 4.5 0.9937
AT1G66230 MYB ATMYB20 myb domain protein 20 (.1) Lus10004042 6.3 0.9937
Lus10011962 7.7 0.9937
Lus10028673 7.9 0.8821
AT2G20340 Pyridoxal phosphate (PLP)-depe... Lus10012601 8.9 0.9937
Lus10022805 10.0 0.9937
AT3G18040 ATMPK9 MAP kinase 9 (.1.2) Lus10027248 10.1 0.8722
AT5G05530 RING/U-box superfamily protein... Lus10024629 11.0 0.9937
AT1G70890 MLP43 MLP-like protein 43 (.1) Lus10012467 11.8 0.8642
AT5G04350 Plant self-incompatibility pro... Lus10029388 11.8 0.9937

Lus10027556 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.