Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G68490 64 / 3e-14 unknown protein AT5G16110 47 / 8e-08 unknown protein AT3G02555 45 / 2e-07 unknown protein AT1G13390 41 / 1e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028474 [exp] 54 / 3e-10 AT5G16110 160 / 8e-50 unknown protein Lus10009170 [exp] 53 / 3e-10 AT5G16110 160 / 7e-50 unknown protein Lus10017599 [exp] 38 / 0.0001 AT5G16110 137 / 8e-41 unknown protein Lus10033560 [exp] 37 / 0.0002 AT5G16110 136 / 3e-40 unknown protein Lus10034327 [exp] 0 / 1 AT1G68490 149 / 1e-46 unknown protein Lus10041444 [exp] 0 / 1 AT1G68490 180 / 5e-58 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G124400 [exp] 66 / 3e-15 AT1G68490 151 / 7e-47 unknown protein Potri.008G121000 [exp] 62 / 1e-13 AT1G68490 150 / 3e-46 unknown protein Potri.012G056500 [exp] 51 / 2e-09 AT1G68490 119 / 2e-34 unknown protein Potri.004G099800 [exp] 50 / 4e-09 AT5G16110 135 / 7e-40 unknown protein Potri.015G047100 [exp] 49 / 8e-09 AT1G68490 116 / 4e-33 unknown protein Potri.017G114700 [exp] 48 / 3e-08 AT5G16110 139 / 4e-41 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027557 pacid=23144524 polypeptide=Lus10027557 locus=Lus10027557.g ID=Lus10027557.BGIv1.0 annot-version=v1.0 ATGCTCGGTTTGGGGAGGAAACGCCGTCCCATTTCTCACCGATCTTCGGTGTCCCACCTCTGTCCGGCCTATCATCATCATCTCCGACTTCCACCGACCT CTACAGGTAGGAAAGGAGGATGCGTCCGGGCAAATTTTGGGGACAAACCGACGGTGAGGGTGGAAGGGTTCGATTGCGTTGACAGGGATATTAGAAACTG CAGCATTCTTGCTCTGGCATAG
AA sequence Show only first row Show all	>Lus10027557 pacid=23144524 polypeptide=Lus10027557 locus=Lus10027557.g ID=Lus10027557.BGIv1.0 annot-version=v1.0 MLGLGRKRRPISHRSSVSHLCPAYHHHLRLPPTSTGRKGGCVRANFGDKPTVRVEGFDCVDRDIRNCSILALA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G68490			unknown protein		Lus10027557 [exp]	0	1
AT2G36960	MYB	TKI1	TSL-kinase interacting protein...		Lus10010230 [exp]	1.0	0.9489
AT1G22620		ATSAC1	suppressor of actin 1, Phospho...		Lus10016941 [exp]	3.9	0.9022
AT4G24190		AtHsp90-7, HSP9...	SHEPHERD, HEAT SHOCK PROTEIN 9...		Lus10035109 [exp]	4.0	0.8985
AT5G25610		ATRD22, RD22	RESPONSIVE TO DESSICATION 22, ...		Lus10006555 [exp]	4.2	0.8525
AT2G17040	NAC	ANAC036	NAC domain containing protein ...		Lus10023966 [exp]	4.5	0.8523
AT5G14930		GENE101, SAG101	senescence-associated gene 101...		Lus10004841 [exp]	5.5	0.9078
AT1G47890		AtRLP7	receptor like protein 7 (.1)		Lus10004309 [exp]	5.7	0.8516
AT3G13040	GARP		myb-like HTH transcriptional r...		Lus10040569 [exp]	8.9	0.8381
AT3G13040	GARP		myb-like HTH transcriptional r...		Lus10040583 [exp]	9.2	0.8417
					Lus10032721 [exp]	9.6	0.7605

Compare expression of checked genes

Lus10027557 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.