Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G41890 38 / 0.0004 curculin-like (mannose-binding) lectin family protein / PAN domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039315 [exp] 144 / 2e-41 AT5G24080 667 / 0.0 Protein kinase superfamily protein (.1) Lus10004365 [exp] 50 / 2e-08 AT5G60900 545 / 0.0 receptor-like protein kinase 1 (.1) Lus10031231 [exp] 49 / 4e-08 AT5G60900 536 / 2e-180 receptor-like protein kinase 1 (.1) Lus10036639 [exp] 47 / 2e-07 AT5G60900 394 / 1e-125 receptor-like protein kinase 1 (.1) Lus10031805 [exp] 47 / 4e-07 AT5G60900 530 / 5e-178 receptor-like protein kinase 1 (.1) Lus10040160 [exp] 46 / 6e-07 AT5G60900 267 / 1e-88 receptor-like protein kinase 1 (.1) Lus10013252 [exp] 40 / 8e-05 AT1G34300 378 / 7e-119 lectin protein kinase family protein (.1) Lus10024195 [exp] 38 / 0.0005 AT5G60900 367 / 3e-114 receptor-like protein kinase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G026300 [exp] 89 / 4e-22 AT5G24080 684 / 0.0 Protein kinase superfamily protein (.1) Potri.001G014600 [exp] 50 / 1e-08 AT5G60900 666 / 0.0 receptor-like protein kinase 1 (.1) Potri.T085150 [exp] 49 / 7e-08 AT5G60900 554 / 0.0 receptor-like protein kinase 1 (.1) Potri.T085000 [exp] 47 / 2e-07 AT5G60900 559 / 0.0 receptor-like protein kinase 1 (.1) Potri.001G014100 [exp] 47 / 2e-07 AT5G60900 669 / 0.0 receptor-like protein kinase 1 (.1) Potri.T085100 [exp] 47 / 3e-07 AT5G60900 554 / 0.0 receptor-like protein kinase 1 (.1) Potri.T084900 [exp] 47 / 3e-07 AT5G60900 548 / 0.0 receptor-like protein kinase 1 (.1) Potri.003G212000 [exp] 46 / 6e-07 AT5G60900 655 / 0.0 receptor-like protein kinase 1 (.1) Potri.003G211366 [exp] 45 / 8e-07 AT5G60900 568 / 0.0 receptor-like protein kinase 1 (.1) Potri.T084450 [exp] 43 / 2e-06 AT5G60900 93 / 5e-23 receptor-like protein kinase 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027558 pacid=23144520 polypeptide=Lus10027558 locus=Lus10027558.g ID=Lus10027558.BGIv1.0 annot-version=v1.0 ATGGCTACTTCTTTACTGTTATCATCATGCACTACTCTGTTCTTTCTTCTGTTTTCGGCTGGGTTAATCCGAGGCTCGTTCGCTGCTGGCCGGATCGGGC TGGGTTCGAGACTGCTGGCTAGAGATCGTGATCAAGCTTGGATTTCGGACAATGGTACGTTTGCATTCGGTTTCACCGAGTCGAACGAGGATCCTGACCG GTTTCAATTGGCTATATGGTTCAATGATCTTCCTGGAGACCGCATCACTGTTTGGTCGCCTAATAGGTATGCACTTAATTAG
AA sequence Show only first row Show all	>Lus10027558 pacid=23144520 polypeptide=Lus10027558 locus=Lus10027558.g ID=Lus10027558.BGIv1.0 annot-version=v1.0 MATSLLLSSCTTLFFLLFSAGLIRGSFAAGRIGLGSRLLARDRDQAWISDNGTFAFGFTESNEDPDRFQLAIWFNDLPGDRITVWSPNRYALN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10027558 [exp]	0	1
AT3G05950			RmlC-like cupins superfamily p...		Lus10026962 [exp]	1.0	0.8989
AT3G30280			HXXXD-type acyl-transferase fa...		Lus10036928 [exp]	1.4	0.8599
AT2G36780			UDP-Glycosyltransferase superf...		Lus10014403 [exp]	1.7	0.8393
AT3G29590		AT5MAT	HXXXD-type acyl-transferase fa...		Lus10041657 [exp]	15.0	0.6665
AT4G08630			unknown protein		Lus10004138 [exp]	17.2	0.7595
AT4G16050			Aminotransferase-like, plant m...		Lus10043051 [exp]	18.2	0.7418
AT1G49290			unknown protein		Lus10041424 [exp]	25.1	0.7135
					Lus10024141 [exp]	27.1	0.7135
AT5G05280			RING/U-box superfamily protein...		Lus10036380 [exp]	29.0	0.7135
					Lus10013255 [exp]	30.7	0.7135

Compare expression of checked genes

Lus10027558 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.