Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24080 120 / 2e-33 Protein kinase superfamily protein (.1) AT2G19130 57 / 4e-11 S-locus lectin protein kinase family protein (.1) AT1G34300 57 / 6e-11 lectin protein kinase family protein (.1) AT4G00340 57 / 7e-11 RLK4 receptor-like protein kinase 4 (.1) AT4G32300 54 / 8e-10 SD2-5 S-domain-2 5 (.1) AT2G41890 52 / 6e-09 curculin-like (mannose-binding) lectin family protein / PAN domain-containing protein (.1) AT1G70250 49 / 3e-08 receptor serine/threonine kinase, putative (.1) AT5G38240 47 / 2e-07 Protein kinase family protein (.1) AT1G66920 47 / 3e-07 Protein kinase superfamily protein (.1.2) AT1G67000 46 / 4e-07 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039315 [exp] 158 / 1e-46 AT5G24080 667 / 0.0 Protein kinase superfamily protein (.1) Lus10031597 [exp] 57 / 9e-12 AT2G19130 145 / 3e-41 S-locus lectin protein kinase family protein (.1) Lus10006052 [exp] 59 / 1e-11 AT1G34300 961 / 0.0 lectin protein kinase family protein (.1) Lus10033748 [exp] 57 / 1e-10 AT2G19130 711 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10028711 [exp] 56 / 2e-10 AT1G34300 704 / 0.0 lectin protein kinase family protein (.1) Lus10013659 [exp] 54 / 5e-10 AT5G20050 244 / 8e-79 Protein kinase superfamily protein (.1) Lus10013252 [exp] 54 / 7e-10 AT1G34300 378 / 7e-119 lectin protein kinase family protein (.1) Lus10034193 [exp] 53 / 1e-09 AT4G32300 202 / 6e-61 S-domain-2 5 (.1) Lus10033032 [exp] 52 / 4e-09 AT5G20050 483 / 4e-169 Protein kinase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G026300 [exp] 111 / 4e-30 AT5G24080 684 / 0.0 Protein kinase superfamily protein (.1) Potri.019G086300 [exp] 61 / 2e-12 AT1G34300 847 / 0.0 lectin protein kinase family protein (.1) Potri.013G115800 [exp] 61 / 3e-12 AT1G34300 858 / 0.0 lectin protein kinase family protein (.1) Potri.019G086200 [exp] 61 / 4e-12 AT1G34300 918 / 0.0 lectin protein kinase family protein (.1) Potri.014G086900 [exp] 60 / 7e-12 AT4G00340 862 / 0.0 receptor-like protein kinase 4 (.1) Potri.019G086400 [exp] 59 / 1e-11 AT1G34300 904 / 0.0 lectin protein kinase family protein (.1) Potri.013G115700 [exp] 59 / 2e-11 AT1G34300 939 / 0.0 lectin protein kinase family protein (.1) Potri.018G070800 [exp] 56 / 2e-10 AT5G20050 516 / 0.0 Protein kinase superfamily protein (.1) Potri.006G254600 [exp] 56 / 2e-10 AT4G32300 965 / 0.0 S-domain-2 5 (.1) Potri.010G103300 [exp] 56 / 2e-10 AT1G34300 375 / 1e-117 lectin protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027559 pacid=23144613 polypeptide=Lus10027559 locus=Lus10027559.g ID=Lus10027559.BGIv1.0 annot-version=v1.0 ATGTCCTTGGAAGCTGAGGACTTCTTCTTCCCTGGATGGGCTTTTAAGGCGATGATGACCGGGACGCACCTGAAAGCAGTGGACAGAAAGCTACTACTCG AGAGCCCAACATCATCAACGACGACGGTGGACGAAGATGAGGTTCTGCGGGCACTAAAGGTGGCGTTCTGGTGCATACAGGACGAGGTGTTCATGAGGCC GTCGATGGGAGAAGCGGTGAAGCTGCTGGAAGGATCGACGGCGGAGATCAAGATGCCACCGATGCCAGCAGACGGTACTTGA
AA sequence Show only first row Show all	>Lus10027559 pacid=23144613 polypeptide=Lus10027559 locus=Lus10027559.g ID=Lus10027559.BGIv1.0 annot-version=v1.0 MSLEAEDFFFPGWAFKAMMTGTHLKAVDRKLLLESPTSSTTTVDEDEVLRALKVAFWCIQDEVFMRPSMGEAVKLLEGSTAEIKMPPMPADGT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G24080			Protein kinase superfamily pro...		Lus10027559 [exp]	0	1
AT3G28857	bHLH	PRE5	Paclobutrazol Resistance 5, ba...		Lus10008626 [exp]	11.0	0.7451
AT2G25140		HSP98.7, CLPB-M...	HEAT SHOCK PROTEIN 98.7, CASEI...		Lus10041018 [exp]	14.2	0.7729
AT3G08590		iPGAM2	2,3-biphosphoglycerate-indepen...		Lus10031877 [exp]	21.4	0.7627
AT2G32120		HSP70T-2	heat-shock protein 70T-2 (.1.2...		Lus10041207 [exp]	25.3	0.7600
AT2G25490		FBL6, EBF1	EIN3-binding F box protein 1 (...		Lus10030102 [exp]	28.5	0.7404
AT1G14360		ATUTR3, UTR3	UDP-galactose transporter 3 (....		Lus10012848 [exp]	30.3	0.7464
AT5G41040			HXXXD-type acyl-transferase fa...		Lus10032020 [exp]	36.7	0.6919
AT5G49910		CPHSC70-2EATSHO...	HEAT SHOCK PROTEIN 70-7, chlor...		Lus10037357 [exp]	39.5	0.7434
AT5G37670		HSP15.7CI	HSP20-like chaperones superfam...		Lus10020815 [exp]	41.7	0.7300
AT2G29500			HSP20-like chaperones superfam...		Lus10016458 [exp]	41.8	0.7236

Compare expression of checked genes

Lus10027559 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.