Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G49142 154 / 2e-45 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G30700 145 / 6e-42 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G47580 135 / 3e-41 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G57430 141 / 1e-40 OTP84 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G46460 140 / 4e-40 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G23330 139 / 1e-39 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G22070 138 / 2e-39 pentatricopeptide (PPR) repeat-containing protein (.1) AT4G33170 137 / 3e-39 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G02750 137 / 5e-39 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G37380 135 / 1e-38 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035815 [exp] 143 / 4e-41 AT4G30700 1026 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10035157 [exp] 131 / 1e-40 AT3G26782 221 / 2e-69 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10000110 [exp] 133 / 1e-39 AT4G37380 413 / 9e-142 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10024971 [exp] 137 / 3e-39 AT4G37380 772 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10016387 [exp] 135 / 7e-39 AT4G33990 717 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10004892 [exp] 135 / 2e-38 AT2G27610 998 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10040577 [exp] 131 / 3e-38 AT1G25360 577 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10028837 [exp] 132 / 4e-38 AT1G11290 650 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10020588 [exp] 129 / 4e-38 AT2G27610 422 / 2e-142 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G005700 [exp] 175 / 4e-53 AT3G49142 912 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.016G075000 [exp] 144 / 9e-42 AT2G41080 755 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.007G050200 [exp] 141 / 7e-41 AT4G37380 817 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G220300 [exp] 140 / 2e-40 AT1G11290 559 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.001G075800 [exp] 140 / 3e-40 AT3G57430 1189 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G252400 [exp] 137 / 5e-40 AT4G21065 496 / 8e-172 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.001G322100 [exp] 139 / 8e-40 AT3G26782 897 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G044700 [exp] 136 / 1e-38 AT3G22690 582 / 0.0 unknown protein Potri.006G181800 [exp] 136 / 1e-38 AT4G30700 1025 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G239600 [exp] 135 / 1e-38 AT5G59200 694 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 80, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10027561 pacid=23144507 polypeptide=Lus10027561 locus=Lus10027561.g ID=Lus10027561.BGIv1.0 annot-version=v1.0 ATGAAACAGTTGGGTTATGCTCCGGAAACTGATTCTGCACTCCATGACGTTGAAGAGGAGGAGAAAGAGTGTCATTTGGCTGTCCATAGCGAAAAGCTGG CTATTGTGTTTGCGATTCTGAATACAAGTCCGGGGACAGCGATCAGAATCACCAAGAATCTCCGGGTTTGCGAGGACTGTCACGTGGCTATCAAGCTTAT GTCTAAGATTACTGGACGTGAAATCATCGTTAGAGACACTAATCGGTTTCATCATTTCCAACATGGCTTCTGCTCTTGTGGAGATTACTGGTGA
AA sequence Show only first row Show all	>Lus10027561 pacid=23144507 polypeptide=Lus10027561 locus=Lus10027561.g ID=Lus10027561.BGIv1.0 annot-version=v1.0 MKQLGYAPETDSALHDVEEEEKECHLAVHSEKLAIVFAILNTSPGTAIRITKNLRVCEDCHVAIKLMSKITGREIIVRDTNRFHHFQHGFCSCGDYW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G49142			Tetratricopeptide repeat (TPR)...		Lus10027561 [exp]	0	1
AT2G25660		EMB2410	embryo defective 2410 (.1)		Lus10022111 [exp]	4.1	0.8001
AT5G02250		ATMTRNASEII, RN...	ribonucleotide reductase 1, EM...		Lus10010842 [exp]	6.9	0.7951
AT2G20020		CAF1, ATCAF1	RNA-binding CRS1 / YhbY (CRM) ...		Lus10034952 [exp]	9.8	0.7898
AT5G04050			RNA-directed DNA polymerase (r...		Lus10036278 [exp]	11.5	0.7738
AT3G22470			Pentatricopeptide repeat (PPR)...		Lus10003426 [exp]	13.7	0.7444
AT3G22630		PRCGB, PBD1	20S proteasome beta subunit D1...		Lus10006596 [exp]	16.9	0.7583
AT5G39840			ATP-dependent RNA helicase, mi...		Lus10034868 [exp]	20.2	0.7408
AT4G37460		SRFR1	SUPPRESSOR OF RPS4-RLD 1, Tetr...		Lus10014863 [exp]	22.1	0.7489
AT1G26930			Galactose oxidase/kelch repeat...		Lus10024239 [exp]	22.8	0.7603
AT3G56550			Pentatricopeptide repeat (PPR)...		Lus10000020 [exp]	23.2	0.7218

Compare expression of checked genes

Lus10027561 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.